KEGG   Bacillus cellulosilyticus: Bcell_0214Help
Entry
Bcell_0214        CDS       T01389                                 

Definition
(GenBank) integrase family protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
233767..234336
Genome map
AA seq 189 aa AA seqDB search
MKVVQPIRDLKQLEAVKAYLRGKNKRDFLLFMVGISSALRISDILKLRVNHVWDGKKPLG
FIEMNEKKTGKYKRFPITPNLTKAIKEYMKEFPEKQREDYLFTSRKGINQPISRQYAASM
LNEACDMVGIKERFGTHGLRKTWALFAFKKGISLDYICMALNHNSIAETKRYIGLLQEDL
DNLYLQVNL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagttgtccagcctattagggatttaaagcagcttgaagcggtaaaagcatattta
cgagggaagaataaaagagactttttactctttatggtgggaatctcatctgctttaagg
attagtgatattttgaaattgcgagttaaccatgtatgggatggaaagaaaccactgggg
tttatagaaatgaatgagaagaaaactggtaaatataaaaggtttccgattacaccgaac
ctaacaaaggctatcaaggaatacatgaaggaatttcctgaaaagcaaagggaagattac
ctgtttacaagtaggaaaggaatcaatcaaccgatttctagacaatatgcagcatcaatg
ctaaatgaagcatgtgatatggtcggaataaaagaacgatttgggacgcacggacttcgg
aaaacttgggctctattcgcatttaaaaaaggtatatcacttgattacatatgtatggcc
ctaaaccacaattctattgctgaaactaaaagatatattgggttgttgcaggaagatctc
gataatttataccttcaggtgaacctatga

DBGET integrated database retrieval system