KEGG   Bacillus cellulosilyticus: Bcell_0217Help
Entry
Bcell_0217        CDS       T01389                                 

Definition
(GenBank) TnsA endonuclease
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
235516..236361
Genome map
AA seq 281 aa AA seqDB search
MIREWNETTINRFLKEKRGQGMGKDYKPWLQVQDIASKGRSTRIFGHTTQRVHHLLSDLQ
LYYFYFLEFDNDVADIREQYPLLDFHDMNIQVDEELTKKLFDKKTQVPHIFTVSFLVTRK
GENGEPYYQARIIKQSHELEKSATLQRIELQRRYFEKKGIDFGIVTEKEINKQLARNIGW
VLNSYDIQDYPILTSNLVHLKRDMVQCLSNKYDTFQGVFSRLERGYSLDEGLGLILFKHL
IANKEISMDLTKKIYLTSSIENYQVEVVGKNGGDNRYAVGH
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgattagagaatggaacgaaacaactatcaataggtttctgaaagaaaaacgaggacaa
ggaatgggtaaagactataagccatggctacaggttcaagatatagcctctaagggcaga
tccactcgcatttttggtcataccacacaaagggtgcatcatctgttgagtgatttgcag
ttatattacttctattttttagagtttgataatgatgttgctgacataagagagcagtat
cctttactagatttccatgacatgaatattcaagtggacgaagagctaacaaagaaactg
tttgataagaagactcaagtaccacatatctttacggtttcttttttggttacaagaaag
ggagaaaatggtgaaccttattatcaagcaagaatcatcaagcaatcgcatgagttggaa
aaaagtgcaaccttgcaacgaattgaactgcaaagaaggtattttgagaagaaagggatt
gattttgggatagttacagaaaaagaaattaataaacaattggcacgaaatattggttgg
gtattgaattcctatgacattcaagattaccccatacttacttccaatttagtgcactta
aaacgggatatggttcagtgtctatccaataaatatgatacgtttcaaggggttttctcc
cgattggaaaggggatatagcttagatgaaggtttgggactaattttgtttaaacattta
atagccaataaagaaataagcatggatttaaccaaaaaaatctatttgacttctagtatc
gaaaactatcaggttgaagttgtgggtaaaaatggtggtgataatagatatgcagttggt
cattaa

DBGET integrated database retrieval system