KEGG   Bacillus cellulosilyticus: Bcell_0218Help
Entry
Bcell_0218        CDS       T01389                                 

Definition
(GenBank) Integrase catalytic region
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
236345..238471
Genome map
AA seq 708 aa AA seqDB search
MQLVINDLLQSTENPDHIQRIVWVDNKNQLCFLVNIRKLSFPYSEGIHNIEASFNRGEII
KVKTDPWAISVDEEDLSESEIEIRDKAWRLINQICLTPEIFDPKQRSALIKIASKDFALS
TKTVRKYLIRYWTRGMIKNALLPDFNNCGKQYGMDRKYNKKAGRKFAYSSSIQRGAITDE
WKEIIRISLEKYYFIRSKPSLKYAYQQMVKEYFSKEDEKSGYKVLDVEKPIISYDQFYYW
YRKWYKPEDAIHKREGRREFLQNYRAITGSATEDSMGIGTYAIDATIGDIYLVSSLDRNI
VIGRSIVYLCVDIFSRTIVGLGVGIENMSGQSLRVALANTFENKKDFCKRTLDMEIGNDD
WPIHYVPHTLLADRGSELISNELTQIVENLNIKIQNTGSYRPELKSVCEKYFHIVQQHIS
PFLPGSIQKDYMKRGGQDYRKKAVLNLSEYTQILVRCVLYYNNHNFLSDYPLTQNMIDEK
IRPIPIEIFKWGLHKGNGQLRTMLLDAIRSNIYPKSQATVTPKGIHFGNLYYTCSKAVKE
RWFSNARIQGNWKMEVYYNPQSVATIYIRIDRQNYEVCSLIEQYEMYRDAKEEELVSLKE
NLRLQKAEYVEAQMNGAMQLAQDIESIVKQAKEKTKDQSLNGEVPKDIKNIRENREKERE
VLKREQQAVIDQQNIGKQLNKVNHDLESVNVLDIFRKKQKEVLRDEDK
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgcagttggtcattaatgatttattacaaagcacggaaaatcccgaccacattcaaagg
atagtttgggtagacaataagaatcaactttgttttttggtcaatatccgtaaattatca
tttccatacagtgagggaatacacaatatagaagcatcctttaatagaggtgagattatc
aaggttaaaacagatccttgggctatcagtgtagatgaagaggatttatcagaatcggaa
attgaaatacgtgataaagcgtggaggctaataaatcaaatctgtttaactccagaaatc
tttgatccgaagcaacgatcagcactcataaaaatagctagtaaggattttgcccttagt
acaaagacagttcgaaaatacttaatacggtattggacaagagggatgataaagaatgct
ctattacccgactttaataattgcggtaaacagtatgggatggatcgtaaatataacaaa
aaggcgggaaggaaattcgcttactcttcttctattcagagaggagcaattactgatgaa
tggaaggaaatcattagaataagcctagaaaaatactactttattcgttcaaagccatca
ttgaaatatgcttatcaacaaatggtaaaagagtatttctccaaagaggatgaaaaatcg
ggctataaagtattggatgtagaaaagccgattatttcatatgaccaattttactattgg
tatcgcaagtggtacaagccggaagatgcgattcataaaagagaaggacgaagagaattt
ttacaaaattatcgagctataactggttcagccacagaagattctatggggataggcaca
tatgccattgatgcaacgattggtgatatatatttagtttcctcgctagatagaaacatt
gttattggtcgaagtattgtatatctttgtgtggatattttttcccgtaccatagtaggg
ttaggtgttggtattgagaatatgtccgggcagtcattgagggttgcattggctaatacc
tttgaaaataaaaaagacttttgcaaacgaacacttgatatggagatcggaaatgatgat
tggccaatacactatgttcctcacactttattggcagataggggaagtgaattaatctcg
aatgaattaactcaaatagtagaaaatctaaatattaaaatacaaaacactggttcatat
agacctgaattaaaatcggtttgcgaaaaatactttcatatcgttcagcaacacataagc
ccgttcctaccaggatccatacagaaagattatatgaaacgaggtggccaagattacaga
aaaaaggcagttcttaacctcagcgaatacactcagattttggttcgctgcgttctctat
tacaacaatcataactttctttcggactatcctttaacacaaaatatgatagatgaaaag
attcggcctatcccgattgagattttcaaatgggggttacacaaaggaaatggccagcta
agaacaatgttattagatgcaattcgaagtaatatttatccaaaatcccaagcaacagta
actcccaagggcattcattttggcaatctttattacacatgctctaaagctgtaaaagag
aggtggttttctaatgctcgaattcaggggaattggaaaatggaagtatattataatcct
caaagtgtagcaactatttacattcggatagataggcaaaactatgaagtctgttcttta
atcgagcaatatgaaatgtatagagatgccaaggaggaagaacttgttagcttaaaggag
aacctgcggttacaaaaggcggaatatgtagaagctcaaatgaatggagctatgcagtta
gctcaggatattgaatcaattgttaaacaggcgaaggagaaaaccaaagaccaatctctt
aatggtgaggttcctaaagatataaagaatattagagaaaatcgagaaaaggagagagaa
gtattgaaaagggaacaacaagccgtaatagatcaacaaaacattggaaagcaattgaac
aaagtaaatcatgatcttgaatcggtaaacgtgctagatattttccgtaaaaaacaaaag
gaagtgcttcgtgatgaagataaatga

DBGET integrated database retrieval system