KEGG   Bacillus cellulosilyticus: Bcell_0220Help
Entry
Bcell_0220        CDS       T01389                                 

Definition
(GenBank) Tn7-like transposition protein D
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
240065..241894
Genome map
AA seq 609 aa AA seqDB search
MIIQFPTPYPDELLFSVIARYHIRSGNVFWKHTLEDLFGKRTISATVLLPSGIGSLVQRL
PKNTTLNEQILIEKHTMYPFYTVFIPTEKAQSIYESMISNDGKKIYMQSGIMASSIPQNK
YLKYCSACAREDIATFGEMYWHRTHQLPGNLICTKHELCLEDSDVLITHSNKHAFILPTT
SNCDLNRKSMITETSLIQLKNIVLQAEDLLNRKYQNQTFSHFTQFYRYHLIEKGYASLKG
QVKQKALYDAFYNLYSEELLNTLCIEPRATQWIANFSRKHRKSFHPYYHLLMLNFFDLKV
NAAFEETSFENTPFGHPNWPCLNATCPDYKKNAIPEITIRRCEKTKKLIGRFTCHTCDFS
YTRKGMDPNKDDCYKFSRIMDFGFLWKRELQLLLNKGLSYREVARILGVDTNTVIKYEKK
NIENKQKAKVRIDSDLVKEHRYEWIHLQRDFPGLSKTELRKKRPEVYAYLYRHDRDWLKV
NSPKRKKVDPTNNRVNWLERDKEILEKVQKVVSELRGIDKKPVRITVKILGDGIGERALL
ERHLDKLPETRVFIEKVSESEQDFRLRRVKYVINEMMEKGEEIKEWKVLRKAAIKKEFYK
EFVDFLKRE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgattatacaatttccaacaccctatccagatgagcttttgtttagtgtgattgctagg
tatcacatccgatcgggcaatgttttttggaaacacacattggaagatttatttggcaag
aggactataagtgccacggtattgttaccttcgggaatcggttctcttgttcagcggtta
cctaaaaacacgacattaaatgaacagatattgatagagaagcatacaatgtatcctttt
tatacagtgttcataccaacagaaaaggctcaatcaatttatgaatcaatgataagtaat
gacggaaaaaagatatatatgcaatccggtattatggcaagttcgataccacaaaataag
tatttaaagtattgttcagcttgtgccagggaagatattgctacttttggagaaatgtat
tggcatcgaactcatcagttacctggtaatctcatttgtactaagcatgagttgtgttta
gaggatagcgatgtattgataactcattctaataaacatgcttttatcttaccaaccact
agcaactgtgatttgaacagaaagagtatgattactgagaccagcttaatacaactaaaa
aatattgttttacaagcagaggatttgctgaatagaaagtatcaaaatcaaacattttct
cattttacacagttttatcgctatcatttaattgaaaaaggttatgctagtttaaaagga
caggtaaagcaaaaagcgttatatgatgccttttataacctttattctgaagagttattg
aataccctttgtatagagcctagggcgacacaatggatagccaatttttcaaggaaacat
cgaaaatcgttccatccatactatcatttgttgatgctcaacttttttgatttaaaagtg
aatgcagcattcgaggaaacttcttttgaaaataccccatttggtcatcctaattggcct
tgtttaaatgctacatgtccagattataagaaaaacgccattccagagataacgattaga
agatgtgaaaaaacgaagaagctaattggacgatttacttgtcacacctgtgacttttct
tatacaaggaagggaatggaccccaacaaagatgattgttacaagtttagtcgaattatg
gattttggtttcctttggaagagggagctgcaattattgttaaataagggattaagttat
cgggaagttgctaggatacttggtgttgataccaatacagtaattaaatatgaaaagaaa
aatattgaaaataaacaaaaggcgaaagttcggattgatagtgatttggtaaaggaacac
cgttatgaatggattcatcttcaaagggattttcctggcctttcaaaaacagaattgagg
aagaaaaggcccgaagtgtatgcttatttgtatcgtcatgatagagattggttaaaggta
aattcaccgaagaggaagaaggtggacccaacaaataaccgagtcaattggctagaaagg
gataaagaaatattagagaaggttcagaaggttgtaagtgagttaagaggcattgataag
aagccagtaagaatcacggttaagatacttggagatggcattggtgaaagagccttattg
gaaagacatttggataagttgccggaaacgagggtgttcattgaaaaagtttctgaatca
gaacaggattttcgtttaagaagggtgaagtatgtaataaatgaaatgatggagaaggga
gaagagattaaagaatggaaggttctgagaaaagctgctattaaaaaggagttttataag
gaatttgttgatttcttaaaacgggagtga

DBGET integrated database retrieval system