KEGG   Bacillus cellulosilyticus: Bcell_0224Help
Entry
Bcell_0224        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
243873..244607
Genome map
AA seq 244 aa AA seqDB search
MKFERLDTVDRILLTSEDSKRLDDWWLNIHEGAFNEFRPVLEEGVIIQELDPHLKFDKDF
VKAHGLTTSLALLYFKQLDDVRVYYEIYRTIGENQVEHILEGTKNYVELKSDLTINKNNH
IGLKIEHAVHYLDAVTSSHIALMNYMELYRDERERVSFQKLRKTKTKKTKKGKKKNTRPI
NMVVYNIKIPDVHITEEERQAYKKMKEAWKVRGHWRTLPSGKKTWIKPHIKGNKEKLEPN
IYHF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaacgtttagacacagtggatagaatcctactgacgtcagaggattcgaaa
cgtttagatgattggtggctcaatattcacgagggagcttttaatgaatttcgcccagtt
ttggaagagggcgtgattatacaagaacttgatccgcacttgaaattcgacaaggacttt
gtaaaggcacacggtttaaccacttcattagctttactgtatttcaaacaattagatgat
gtgcgggtctattatgaaatttaccggacgattggtgagaaccaggtggaacatattttg
gaaggcaccaagaattatgttgagttaaaaagtgaccttacgataaacaaaaataatcat
atcggtctaaaaatagaacatgctgtccactatctggacgctgttacttcaagccatatc
gctttgatgaattacatggaactgtatagggatgagcgggagcgagtatcatttcagaaa
ttgcgaaaaactaaaactaaaaaaactaaaaaaggaaagaaaaagaacactcggccaata
aatatggtggtttataatataaaaattccagatgtacatattactgaagaagaaagacaa
gcatataagaaaatgaaagaagcatggaaggtcagaggacactggagaaccttgccatca
gggaaaaagacatggataaagcctcatataaagggaaataaagaaaagctggaaccaaat
atctatcacttttag

DBGET integrated database retrieval system