KEGG   Bacillus cellulosilyticus: Bcell_0229Help
Entry
Bcell_0229        CDS       T01389                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcell_0229
   01230 Biosynthesis of amino acids
    Bcell_0229
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_0229
  Energy metabolism
   00680 Methane metabolism
    Bcell_0229
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_0229
Enzymes [BR:bco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcell_0229
Exosome [BR:bco04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcell_0229
  Exosomal proteins of melanoma cells
   Bcell_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
250995..251546
Genome map
AA seq 183 aa AA seqDB search
MNKNIYIIRHCEAIGQSSDSPLTERGFTQANELSDFLSNIKVKVDRIISSPYLRAVQTIK
PFAENKNMELEMDRRLTERILSSTFFPDWMDKLEATFKDMDLKYEGGQSSNEAMNRIVEV
VNDIVASDSENTIIVAHGGVISLLLNHYDKKFGFEQWKGLSNPDVYQLRILQNNFDIKRL
WND
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatatatacataattagacattgtgaagcgataggacaatcttctgattca
ccattaacggaaagaggattcacacaagcaaatgaactatctgactttctatcgaatata
aaggtaaaggttgatagaattatttccagtccttacttgcgagcggttcaaacgataaag
ccatttgcagagaataaaaatatggaacttgagatggataggcgactaactgaacgtata
cttagctccaccttttttccagattggatggataaactggaagcaacattcaaggatatg
gatttgaagtatgaaggtggacaatccagtaatgaagccatgaatcgaattgtagaagtt
gtaaatgacattgtggcaagtgattctgaaaatacgattatcgtggcacatggaggagtt
atatccttattattaaatcactatgataagaaatttggctttgagcaatggaaaggtctg
agtaatccagacgtgtatcaattgaggatattacaaaacaactttgatattaaacgatta
tggaatgattaa

DBGET integrated database retrieval system