KEGG   Bacillus cellulosilyticus: Bcell_0231Help
Entry
Bcell_0231        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
252447..252881
Genome map
AA seq 144 aa AA seqDB search
MRNQEEDLYEYNRVKKETYKKSLLGCFLAILLIILIPIIYVGGVFISSVNEEQVITESTS
PNNLEKITIIQKGGGFLHRGSTVILKSSNDSIKVPIHEGSSLQELEIHIYWENDEEATIS
ILEGYVISFNKSNSLLEKSFKVVE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatcaggaagaagacctttacgaatataatagagtaaagaaagaaacctacaaa
aagtcattattaggatgttttctagcaattctacttattattttaatcccaatcatatat
gttggtggcgtttttatttctagtgtaaacgaagaacaggttattactgaaagcacatcc
cctaataatctagaaaaaataactatcattcaaaaagggggaggcttcttacatagagga
agcacagtaattttgaaaagtagcaatgattctataaaagttccgatacatgaaggatct
tcactacaggaacttgaaatccatatttattgggaaaatgatgaagaagcaacgattagt
atactagaaggatatgtcatttcatttaataaaagtaatagtttgttggagaagtcgttc
aaggttgttgagtaa

DBGET integrated database retrieval system