KEGG   Bacillus cellulosilyticus: Bcell_0233Help
Entry
Bcell_0233        CDS       T01389                                 

Definition
(GenBank) multidrug resistance protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
253429..253761
Genome map
AA seq 110 aa AA seqDB search
MNKTAAIVGLITNLLFGYILVKYLLIVYLLFFLSFTQLIGWNLDPTMEEGLFFPMLIISL
LVTALYFIPLTLLNIKVYCILRVTKVNYIMGIVLLIIIGGIIGFDFDKFY
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaactgcggctattgtcggactgattactaatcttctgtttgggtatatccta
gtcaaataccttctcatagtatatctattgttttttctatcgtttacgcagctaattggt
tggaatcttgatccaactatggaagaagggttattttttcctatgcttatcattagtctc
ttggtaacagcattgtattttataccgctaactctgttgaatattaaagtttactgcatc
cttagagttaccaaagtgaactacatcatgggaattgtcttactgataattattggaggg
ataatagggtttgactttgataaattttattga

DBGET integrated database retrieval system