KEGG   Bacillus cellulosilyticus: Bcell_0236Help
Entry
Bcell_0236        CDS       T01389                                 

Definition
(GenBank) polysaccharide deacetylase
  KO
K22278  
peptidoglycan-N-acetylglucosamine deacetylase [EC:3.5.1.104]
Organism
bco  Bacillus cellulosilyticus
Brite
Enzymes [BR:bco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.104  peptidoglycan-N-acetylglucosamine deacetylase
     Bcell_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
255680..256891
Genome map
AA seq 403 aa AA seqDB search
MLAYGVKLLELLSIDKTAEKSFLKIRLVLDEEVVLFWEIDDDTASYLVGLTLREEGHKYR
LSFHSSRNSVNNRNISWLTKTYKDNSERINFTCSDDYINQLKRIKSIEKIKDIDALPFLT
SALKEEKDEQVAEEDTLYLRRPAWRIALILSITILTVFSFSSYKYFYNPVYGDNPKLINE
YEKKEITLKKKEQRANRLSYEETKGTGYIPYIELKDLITYGLPEGSVAITFDDGPSEYTT
DIIDILNEYQVGGTFFFIGKNVIKHPSSVQYVNENGYSIGNHGYTHMNFIKLSEEGQENE
LLKTNRLIEDITQERVTMFRPPYGSFNDDVIDLMGNKEMNMVIWNVDPKDWKSPNSTKIV
DHLHSSDMSGSIILLHETKMVVEALPEIIEYLQNEDLQIVNLR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctagcttatggggtaaagctattggaattactgtcaattgacaaaacagcagagaaa
agttttctaaaaataagattagtgttagacgaggaagtggtgctattttgggaaattgat
gatgatacagcgtcgtacttagtggggctcacattgagagaagaggggcataagtatcga
ctttcatttcacagtagccggaattctgttaataaccgcaatataagttggttaacaaag
acatataaggacaatagtgaaagaataaattttacttgtagtgacgactatattaatcaa
ttaaagcgaataaaaagtatagaaaaaataaaggacattgacgcacttccttttttaact
agtgctcttaaagaagaaaaagatgagcaggttgctgaggaggatacactatatctccgg
cggcctgcatggagaatagcacttatattaagtataactatccttactgttttttctttc
tctagttataaatatttctataatccagtttatggagataacccaaaactaattaatgag
tatgaaaaaaaggaaattacattaaagaaaaaggagcaacgtgcaaatagattaagttac
gaagaaacaaaagggacaggatatattccatacatagaattaaaagatttaattacatat
ggtcttccagaaggtagtgttgcgattacctttgatgatggaccttcagagtacacaaca
gacattatagatatactcaatgaatatcaagtgggtgggacttttttctttattggaaaa
aatgtaataaaacatccatcttcagttcaatatgtgaacgaaaatggctattctattggt
aatcatggttatactcatatgaattttattaaactttcagaagaagggcaagagaatgaa
ttattaaaaacgaatcgtcttattgaggatataacacaagaacgtgtcactatgtttagg
ccaccttatggatcatttaatgatgatgtcatagatttaatgggaaataaagaaatgaac
atggtgatttggaatgtagacccaaaagattggaaaagtccaaatagcaccaaaattgtg
gatcacttacatagcagcgatatgtctggatcgattattcttctacatgaaacgaaaatg
gttgtagaagcattaccagaaataattgaataccttcaaaatgaggatttacaaatagtg
aatttacgttga

DBGET integrated database retrieval system