KEGG   Bacillus cellulosilyticus: Bcell_0243Help
Entry
Bcell_0243        CDS       T01389                                 

Definition
(GenBank) Methionine sulfoxide reductase A
  KO
K07304  
peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
bco  Bacillus cellulosilyticus
Brite
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     Bcell_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(261053..261706)
Genome map
AA seq 217 aa AA seqDB search
MKNTYDIQATTIAFATFGMGUFWGPDARFGHLPGVVRTRVGYAGGTLKDPTYRNMGDHTE
VLQVQFDPTILSYKDILRLFWKHHHGFKDSFYKGRQYMSLLLYHNQQQQQDAEEIKLEIE
ETHQQTLQTEVAPFSTFYVAEDYHQKYYLKRYKHVIEKLHDVFPTDDELVNATLVARLNG
FVKEHGTLADLSKEIPNWGISQSRIDELLFLLKSIKW
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacttatgatatacaagcaactacgattgcttttgctacttttggtatgggt
tgattttggggtccagatgcccggttcggacatcttccaggagtggtaagaacacgtgtc
ggatatgcaggtggcactttaaaagatcctacttatcgtaatatgggtgatcatacagaa
gtactgcaagttcaatttgatccgactattttaagttataaagacattttacgtttattt
tggaaacaccaccatggatttaaagatagtttttataaaggtaggcaatacatgtctcta
cttctataccataatcagcagcaacaacaagatgcagaagaaataaaattagagatcgaa
gaaacacatcaacaaacgttgcaaactgaggtagcacctttttctacgttttatgttgca
gaagattatcatcaaaaatattatctgaaaaggtataagcatgttattgaaaaattacac
gacgtttttcctaccgatgatgagctcgtgaatgctactttagttgccaggttaaatggc
ttcgtaaaggagcatggtacattagccgacttatcaaaagaaataccgaattgggggatt
tctcaaagtcgtatagacgagttattattcctcctaaaaagtatcaaatggtaa

DBGET integrated database retrieval system