KEGG   Bacillus cellulosilyticus: Bcell_0245Help
Entry
Bcell_0245        CDS       T01389                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
262669..263559
Genome map
AA seq 296 aa AA seqDB search
MELHQLRSFYYVATYLNFSRAAEKLLVSQPAVSRQIEALERLYGLPLFYRSKKKVELTPA
GRELLTYAKKMMTLAEDAKEALLTLKNGDSGELHVGCGTTIGNFAITALVVHFQKKYPNI
HIHLDIDNTDTIINKLNERKLDVAIIAKDVDREAFNVDSLFQDNIHLVCLAEEMQKYKQS
QSLDQLENETYILRKRGSHTRECVDEYFKTMNFQPQNIIEVNNNEAIKQAVIQKLGVGFL
SSITYKIEREHQILRQIRLQKPSKREFSFIYPKGKYYSTVMEMFHTFLKDNMSKIT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaactacaccagttaagatcgttttattatgtagcgacgtatttaaacttttcaaga
gctgcagaaaagctcttggtgagtcagccagcagtatcgcggcaaatagaggctctagag
cgcctttatggactcccattgttttaccgatctaagaaaaaagtagagttaacccctgcc
ggaagagagcttttaacttatgcaaaaaaaatgatgacgttagctgaggatgcaaaagaa
gctttattaacacttaaaaatggtgatagtggagaattacatgtaggttgtggaacgaca
attggtaattttgctattacagcattagttgtacatttccaaaagaagtatcctaatatt
catatccatctagatatagataatactgatacaatcattaataaattaaatgaacggaag
ctagatgttgccattattgcaaaggatgttgaccgggaggcgtttaacgtcgattcgctt
tttcaagataacattcatttagtatgtttagcggaggaaatgcaaaagtacaaacagagt
caatcgttagaccaactagaaaatgaaacgtacattttacgaaagcgaggatcacacaca
cgagaatgtgtcgatgagtatttcaaaacaatgaactttcagccgcaaaatatcattgaa
gtcaataataacgaagcaattaagcaagcagttatacaaaaacttggtgtcggatttctt
tcctctattacatacaaaatagaacgtgagcaccaaatactacgtcaaattcgattgcaa
aaacctagtaaaagagagttttcttttatttatccaaagggaaaatactattcaacggtt
atggaaatgtttcataccttcctaaaagataatatgagtaaaattacataa

DBGET integrated database retrieval system