KEGG   Bacillus cellulosilyticus: Bcell_0250Help
Entry
Bcell_0250        CDS       T01389                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
  KO
K07689  
two-component system, NarL family, invasion response regulator UvrY
Organism
bco  Bacillus cellulosilyticus
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:bco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcell_0250
Two-component system [BR:bco02022]
 NarL family
  BarA-UvrY (no operon) [MD:M00475]
   Bcell_0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
270126..270740
Genome map
AA seq 204 aa AA seqDB search
MRLLIGLDHELLRNGLVHLLKDVRQVEYMVLATSTEMFIESVQKYEFDLIVVDADLRGAG
GLRSLISILEILPHTTKKVFMYNSLHPELEELLMNKDIQGLFYEQSPLGDLMSFFEKVLN
GEQAFLNNGSPRNYREIDEEFHELSKREEEVFYMKLRGYTVKDTAQILNISPKTVENHRR
NIRKKLNIHKGSEWYDWGKKLGVI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttaatagggttagaccatgagctattaagaaatggtttagtacacctttta
aaagatgttcgacaagttgaatatatggtgttagcaacttcaacagaaatgtttatcgag
tcagtccaaaagtatgaatttgatttaatcgttgtcgacgctgaccttcgaggagcaggc
ggattacgaagcctcatctccatccttgaaattttacctcacacaacgaaaaaggtgttc
atgtataatagtttacacccagaattagaagaattgttaatgaataaagatattcaaggc
cttttttacgagcaatctcctttaggagacttaatgagttttttcgaaaaggttttgaat
ggtgagcaagcgttcttaaataatggtagtcctagaaactacagagaaatagacgaggag
tttcacgagctttcaaagcgtgaagaagaagtattttatatgaagcttcgtggctacact
gttaaagatacagcacaaatattaaacatttctccaaagactgtggagaaccatcggcga
aatattagaaagaagttgaacatacataaaggcagtgaatggtatgattggggaaaaaaa
ttaggtgtcatttaa

DBGET integrated database retrieval system