KEGG   Bacillus cellulosilyticus: Bcell_0252Help
Entry
Bcell_0252        CDS       T01389                                 

Definition
(GenBank) ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydC
  KO
K16012  
ATP-binding cassette, subfamily C, bacterial CydC
Organism
bco  Bacillus cellulosilyticus
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:bco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Bcell_0252
Transporters [BR:bco02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Bcell_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
272780..274504
Genome map
AA seq 574 aa AA seqDB search
MKELNIVIKLMLVEKKDVLYSILFGFLAGIAAVSLFANSGYLISKAAINPPLYILTVSIA
LLKFFSFTRALSKYAERYYSHRATFTILSNLRVKFFEKLEPLAPKVFHKYRSGDLLARIV
GDVESLQNFFLRVYYPPIIMVIVFLATIAFTTFFSVEVAVALVVGLFITGFIIPMIFAVR
QRAIENQLRSVRGSVSTEATEFLYGFRDLKLYQRLEQQEKNLIDASNTYVDEQSKESVHA
LYAQSLNQTITLLVSWVILAMGAYLVSAGTLDGVFLAMLVMISLTVFENATPMAAFPSHF
EDSRRAAGRLFTIVGEEDIDQNETVPKEKMSTNVAPAIKLNDVTFIYPEETRPALKHLNL
TIPAGSKTAIVGPSGSGKSTFMQVLLKMYTSYDGTFDVNGVSLSKLDESSIWETSNVVLQ
HNHFFYGTIRDNLLLVSEDLSDAEMESALRKVQLDTFSLYDQVLEKGENLSGGEKQRLAI
ARAMLKQSRLWLLDEPTSSIDVLTEAAIYHNLFEESKEDTLVLISHRLTGLEMMDQIIVM
EQGTVIEAGSFDELMEKQGYFYEMKQIEKSVFTA
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagttaaacattgtaataaaactcatgctagtcgagaaaaaagacgtcctgtat
tcaattttatttggttttttagctggaatagccgcggtaagtttatttgcaaacagtggc
tatttgatttcaaaagcagcaataaacccgccattatacattttgacagtaagcattgcg
ttacttaaattttttagctttactagagcattaagtaaatatgctgaacggtattattcg
catagggcgacattcacgatattaagtaatttaagagtgaagttttttgaaaaactcgag
ccattagcaccaaaggtatttcataaatatcgcagtggagatttattggcaagaattgtc
ggcgatgtagagagcttacaaaactttttcttacgtgtatattatccaccaatcattatg
gttatcgttttcttagcaacgattgcatttactacttttttctcagtagaagtggcagta
gcactcgttgtaggcctattcatcacaggttttatcattccaatgatattcgctgttcgt
caaagagcaattgaaaatcagttaagaagtgtacgaggatctgtttcgacggaggcgact
gagtttttatatggctttcgtgatttaaagctataccaacgacttgaacagcaagagaaa
aatttaatcgatgcatccaacacgtacgtagacgagcaaagtaaagagagtgtacatgct
ttatatgcgcaatcgcttaaccaaacgattacgttactagtatcttgggtgatattagcg
atgggtgcgtaccttgtcagtgcaggcactttagatggcgtgtttttagctatgctcgtc
atgatatccttaaccgtctttgaaaatgcaactccgatggctgctttcccaagtcatttt
gaagacagccgtcgagctgccgggcgcttatttaccattgtaggtgaagaagatattgat
caaaatgaaacagttcctaaagaaaaaatgtccacaaatgttgcaccagctattaaattg
aatgatgtaacctttatctatccagaggaaacacgtccagcactgaagcatttaaactta
acaataccagctggctcaaaaacagctattgttggtccgagtggttctgggaagtctacc
ttcatgcaagtactattaaaaatgtatacttcctatgatgggacatttgatgtgaacgga
gtaagcttatctaaattggatgaatcgtcgatttgggagacatccaatgtcgtcctacag
cacaatcactttttctacggaacaattcgagacaatcttttgttagtaagcgaggactta
tcagatgcagagatggaatccgctctacgaaaggtgcagctagatacgttttccctatat
gatcaagtgttggaaaaaggggaaaacttgtctggtggagaaaaacagagattggcgata
gcaagagcgatgctaaaacaatcgcgcctttggttattagatgaaccgacatcttcgata
gatgtgttaacggaagcggcaatctatcacaacctttttgaagaaagtaaagaagatact
cttgtactcattagtcaccgactaactggcctagaaatgatggaccaaattattgtaatg
gaacagggaaccgtcatagaagcaggctcgttcgatgagctgatggagaagcaaggctac
ttctacgaaatgaagcaaatcgaaaaaagtgtattcaccgcgtaa

DBGET integrated database retrieval system