KEGG   Bacillus cellulosilyticus: Bcell_0261Help
Entry
Bcell_0261        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(282472..283548)
Genome map
AA seq 358 aa AA seqDB search
MKNMTLLIGLITIALIGAGCTSSQVGVSADELYSNILSTNDDFFAYYAEGEMTFHYGDGL
SEKATFKEHVSQEGKRKVITIDNATNQQSIAVNDGFDLYFYEEANDTAIKIDLSDEAIPT
LTHREQVTSMLENMKDTHYYEVKGEVVVNGIDTYHMVLTAKESNLLIGDIELWVDKKTWF
MVKGISVAGDITTTIEYKEIDFSPQFDDDTFTIDLPSHITFTEVNDTLNESIKIIDSISD
AEEIVQTPFYLFDEEDLSLLSIESYSLSGEIQEEVTLYYWKNDIPYLSLSVAPTYNEDAY
LGGEKVTIRGSIVAEYLESLRYLIWDENNIQYSISILHPDVELDDIIQLVNEMKLSND
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacatgactttactcatcgggctgatcaccatagccctaattggagccggatgc
acttcctcacaagtaggggtttcggctgatgagctatattccaatattttatctactaat
gatgattttttcgcttactatgctgaaggtgagatgacctttcattacggcgatggtctt
tctgaaaaagctacctttaaagaacatgttagtcaagaagggaaaagaaaggttattacg
attgacaacgctacaaaccaacaatcaattgcagtaaatgatggttttgacttgtatttt
tatgaagaagctaatgatactgccattaaaatagatctctctgacgaagccattcctacg
ttaactcatagggagcaagtaacctcgatgctagaaaacatgaaagacacacattactat
gaagtaaaaggtgaagtagtcgttaatggaatagatacttatcatatggttcttactgcg
aaagagtcaaatttactaataggtgatatcgagttatgggtcgataaaaaaacatggttc
atggtgaagggaatatctgtagctggtgatattacaactaccattgaatataaggagatc
gattttagccctcagttcgatgatgatacctttacgattgatttaccgagtcatattaca
tttacagaagtgaatgatacgttaaatgaaagtatcaagattattgactcaatttcagat
gcagaggaaatagtgcaaacacctttttatttattcgatgaagaggacttaagcctccta
tcgattgaaagttattctctttccggtgaaatacaagaggaagttactctctattattgg
aaaaatgatattccttatttatcattaagtgttgcacccacttataatgaagatgcatat
ttaggaggtgaaaaagtaacgatacgtggtagtatcgtagcagaatatttagagagcttg
aggtatctcatttgggatgaaaacaatattcaatattctatctctatccttcaccctgat
gtagagttagatgatataatacaacttgtgaatgaaatgaaattgagtaatgattaa

DBGET integrated database retrieval system