KEGG   Bacillus cellulosilyticus: Bcell_0269Help
Entry
Bcell_0269        CDS       T01389                                 

Definition
(GenBank) Coat F domain protein
  KO
K06329  
spore coat protein F
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
290521..290994
Genome map
AA seq 157 aa AA seqDB search
MSQGHLAWHETLEIHELVAAQSIGLMKMKKAIKDINNQELHGIYESAIKGVTNNLMELIA
FYPDMPRAESTMTEKELEGLYAGDLLTFSKMSVRNYAIAITEAATPEVRKVFQKHLNNAI
DLHGKVFNYMYKTGKYPAYDLDKLLKNDLQLARKALK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaggtcatttagcttggcatgaaacgttggaaattcatgagttggtagcagca
caatcaatcggtttaatgaagatgaaaaaagcaataaaggatattaataaccaagaatta
catgggatttatgaaagcgcaattaaaggtgttacaaataatttgatggaacttatagca
ttttatcctgatatgccaagggcagaaagtacgatgacagaaaaagagttagaaggtttg
tatgcaggtgacttactcactttttctaaaatgagtgttcggaattacgcgattgcaatt
acagaagcggcaacacctgaagttagaaaggtatttcaaaagcatttaaataatgcgatt
gatctacatgggaaagtatttaactatatgtataaaacaggaaaatacccagcgtatgat
ttagataagctgttaaaaaatgacttgcagctagcaagaaaagcgttgaagtaa

DBGET integrated database retrieval system