KEGG   Bacillus cellulosilyticus: Bcell_0282Help
Entry
Bcell_0282        CDS       T01389                                 

Definition
(GenBank) beta-galactosidase
  KO
K05350  
beta-glucosidase [EC:3.2.1.21]
Organism
bco  Bacillus cellulosilyticus
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcell_0282
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Bcell_0282
Enzymes [BR:bco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Bcell_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
304666..306030
Genome map
AA seq 454 aa AA seqDB search
MAIIQFPKDMRWGTATASYQIEGAANIDGRGPSIWDTFSKTPGKVLNGDNGDVACDSYHR
YKEDVAIMKDLGITTYRFSFAWPRVIPNGTGEVNQLGLDFYHNFIDELIANDIEPMATLY
HWDLPQALQDKGGWGSRETIDAFVEYAELMFKEFNGKIKYWITFNEPWCASFLSHYGGEH
APGFTDLQLGMDAAHHMLVSHGKAVQKYRELGVKGGQIGYAPNVEWNEPYSNKQEDIDAC
RRAGGFFIEWFMDPVFKGSYPQFMLDWFKEKEGVEPPIQDGDLEIISQPIDFLGINYYTG
SVGRYVEDQAAQQHSLFNHERVDQGYQKTDIGWNVYPEGFYNVLKYVTDLYGQVPIYITE
NGSCYNDEPENGVVKDDKRIDYLRQHLTALRRAMDSGVNIKGYMTWSLLDNFEWAWGYSM
RFGIVHVNYRTLERTKKDSFYWYKQTVANNFFEV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattcaatttccaaaggacatgagatggggtactgcaacagcgtcctatcaa
attgaaggagcagcaaatattgatggaagaggtccatctatttgggatacgttctccaaa
actcctggtaaagttttaaatggagataatggggatgtagcttgtgatagttatcaccgt
tataaggaagacgtagcaattatgaaagatttaggaattactacataccgtttctccttt
gcgtggccaagagttattccaaacggtactggtgaagtaaaccagctaggtttagatttt
taccataattttattgatgagttaattgctaatgatattgagccaatggcaacactttat
cactgggatctaccgcaagcgttacaagataaaggtggttggggtagccgtgaaacgatc
gatgcatttgttgagtatgcagagcttatgttcaaagaattcaacggaaaaattaagtat
tggattactttcaatgagccttggtgtgcatctttcttatctcactacggtggagagcat
gcgccaggatttacagatttacaattagggatggatgcagcgcatcatatgttagtttct
cacggtaaggctgttcaaaaatatcgtgaacttggtgttaaaggtggccaaatcggctat
gcacctaacgtagaatggaatgagccatacagtaacaaacaagaggatattgatgcttgt
cgccgtgctggtggattctttatcgagtggtttatggatccggtatttaaaggttcttac
cctcaatttatgcttgattggttcaaagaaaaagaaggtgttgagccaccaattcaagat
ggtgatttagaaattatttcacaaccaatcgacttccttggtattaactattatacaggt
agcgtaggacgttatgtagaggatcaagctgcacaacagcattccttatttaatcatgaa
cgtgtagatcaaggttaccaaaagacagatattggttggaacgtatatccagagggcttt
tataatgtactgaaatacgttacagacctttacggacaagtgccaatttatattacagag
aacgggtcttgctacaacgatgagccagaaaatggggttgtaaaggacgataagcgtatc
gactacttaagacaacatttaactgcacttcgccgtgcgatggactctggtgtaaacatt
aaaggatatatgacttggtcgttacttgacaattttgagtgggcttggggctactctatg
cgcttcggaattgtacacgtaaattaccgtacattagagcgtacgaagaaggatagcttc
tactggtacaagcaaacagtagctaacaacttctttgaagtataa

DBGET integrated database retrieval system