KEGG   Bacillus cellulosilyticus: Bcell_0283Help
Entry
Bcell_0283        CDS       T01389                                 

Definition
(GenBank) Xylose isomerase domain-containing protein TIM barrel
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
306192..307025
Genome map
AA seq 277 aa AA seqDB search
MRLGGPVFFKNHDAESWAEAVKVEGYRAALCPVNYEDGEETINAYKRSAIKNDIVIAEVG
AWSNPISPDDEMRRSAIEHCKRQLELAEMLEAKCCVNIAGSRGEQWDGPHVDNFSDDTFT
LIVDTVREIIDAVQPKHTFYTLEMMPWVYPDSSDTYLALIKAIERDAFAVHYDPVNIITS
PRNYYNNKNMIRDFFKKLSPYIKNCHAKDINLLGKLTVHLEEVIPGKGLLHYQTLLTELN
KLDKDTPLIIEHLSTEAEYREAANYIRSVANTMNIDL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagactaggtggtccggttttttttaaaaatcatgatgctgagagctgggcagaagca
gtaaaggtggaaggctacagagcagctttatgccctgtgaattatgaagacggtgaggag
acaattaacgcctataaacgctcagcgatcaagaatgatatcgtcatagcggaagtaggg
gcttggagtaacccgattagcccggacgatgagatgcggagatctgcgatagagcattgt
aaaaggcagttggagctagctgaaatgttagaggcgaagtgttgtgttaatattgcagga
tcacgtggggaacagtgggatggtccgcacgttgataactttagtgacgatacatttacg
ttaatagtcgatacagtaagagagattatagatgccgttcaaccgaaacatactttttat
acgttagagatgatgccatgggtttatcccgactctagtgatacatatttagctttaata
aaggcaattgaacgtgatgcttttgctgttcattatgatccggttaatatcattactagc
cctagaaattattataataataaaaatatgataagggatttcttcaagaaattatcgcct
tatataaaaaactgtcatgcgaaagatattaacctattagggaaattaactgttcattta
gaagaagtcataccgggtaaaggattattgcattatcaaacgctattaacagagctaaat
aagcttgataaagatacgccgcttattatcgagcatctttctacggaagcggaatataga
gaggctgctaactacatccgaagtgtagcaaatacgatgaacattgatctatag

DBGET integrated database retrieval system