KEGG   Bacillus cellulosilyticus: Bcell_0284Help
Entry
Bcell_0284        CDS       T01389                                 

Definition
(GenBank) Ferritin Dps family protein
  KO
K04047  
starvation-inducible DNA-binding protein
Organism
bco  Bacillus cellulosilyticus
Brite
Chromosome [BR:bco03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Bcell_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(307113..307553)
Genome map
AA seq 146 aa AA seqDB search
MNERKLYEALNLHLANWNIIGSKLRQFHWFVKGPDFFTLHEKFEELYNEATSYVDEIAER
HLSIGGTPISTLREFIDNASIEEVDGNLHAKEMVANVTDDFTLMTEELNDAIFIAEENND
HVTADLFISMKASVEKHIWMLKAYLS
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacgaaaattatacgaagctttaaatttacatttagcaaactggaatatcata
ggtagtaagctgcgccagtttcactggtttgtcaaaggaccggatttttttacacttcac
gaaaagtttgaagagttatataacgaagcaactagctatgtcgatgaaattgctgaaaga
catttaagtatcggtggaacaccaatttctacattacgggaatttattgacaatgcttcc
attgaagaagtagatggcaaccttcacgctaaggaaatggttgcaaatgttacagatgat
tttacacttatgacagaggagctaaacgacgctattttcatagcagaagaaaataatgat
cacgtcacagctgacctttttattagtatgaaagcttccgtagaaaaacacatatggatg
ctaaaagcttacttatcttaa

DBGET integrated database retrieval system