KEGG   Bacillus cellulosilyticus: Bcell_0285Help
Entry
Bcell_0285        CDS       T01389                                 

Definition
(GenBank) diguanylate cyclase/phosphodiesterase with extracellular sensor
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
307759..310047
Genome map
AA seq 762 aa AA seqDB search
MKLKVKTAIVILSSVFTLLVILFISINPIMLSQYKQLELELVEQNNERVKSALNNELNRL
KMIVRDYSVWDDTYQYMQDGNEQYINSNWVEDTFNTNNINFVVYISEEGELLYDQGYDAV
TDSSVHIEELLDWEELQPFIFEQNSVIILGHEHPIFVASHQIYPSLQNAPANGVLLMGSV
IDSTVVEALSATTQLPLELSLSQQYEESTVKLLNDELIQGNYFFPIEGTSLEGNLSFTLD
RDVYQSGRRGLIGFFTLYALISLCLTAICIYSLDKFILSRFTTLSDQLKEIQQSRDLNKR
IVVSGNDEISSLKRAINHMLYALFQSQTEIQKLALTDELTGLSNRNDFRSRFEVMVKAEA
QQRIAILFIDIDLFKRINDALGHYVGDTVIKETSKKLKENIPPDAIVGRWGGDEFIVALP
FEEEREVVTLSKQLLLDIARPIVMKGYTFEITSSIGISTAPNDAKEPEDLIRQADIAMYE
AKRHGKNQYRFYQDVAKYAYFNHYVSLENDLRYALQNNEFNIYYQPIMNADGNVLGVEAL
LRWENRDKGMIPPDKFIPVAEELGMMPFIGKWVLKESIRQVKRWHELGYEDISLSVNVSK
TQLVSNDFCSIVKTTLEECDFPPELLVLEITESDVAIYMEKLTLASKVLTEMGVKISLDD
FGMGASSLHYLKEIFVDQLKIDRSFVNGIPSDSFDSALLSGIVTLCKKLKIEVVAEGIET
EEQYIYLKEDNISLQGYYFSKPLPKDEVEMFIIEKNNSIENR
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaaaagttaaaaccgccattgtcattctatcaagtgtattcactcttttagtt
attttatttatttccattaaccctattatgttaagtcaatataagcagttggagctagaa
cttgttgaacaaaataacgaacgtgtaaaaagtgcgctaaataatgagttaaatcgctta
aaaatgatagtacgtgattattccgtatgggatgatacatatcaatatatgcaagatgga
aatgaacaatatattaatagtaattgggttgaggacacgtttaatactaacaatattaac
tttgttgtatatatatctgaagaaggtgaattgctatacgatcaaggctatgatgctgtc
acagactcatctgtacatattgaggaattactggattgggaagagctacaaccattcatt
tttgaacaaaatagcgtaatcattcttgggcatgaacaccctatttttgtagcgtcacat
caaatataccctagtctacaaaacgcaccagcaaatggggttttgttaatggggagtgtg
atagattcgactgtagtcgaagcgctttcggctacaactcagttacctctcgaactaagc
ttaagccaacaatatgaagagtcaactgtcaaactgttaaatgacgagttaatacaaggg
aattatttttttccaattgaagggacttcattggaaggtaatttaagctttacgcttgat
agggatgtttatcaaagtggacgaaggggtttaataggcttttttactttatacgcttta
ataagcctatgtcttactgctatttgtatttactctttagataagtttatcttatcaagg
ttcactactttatcggatcaactaaaggaaatacaacaatctcgagatttgaacaagagg
attgttgtaagtggaaatgacgaaatatccagtttaaagcgtgcaattaatcacatgctg
tatgctttgttccaatcgcaaacagaaatacagaagctcgcattaacggatgaattaaca
ggtctttctaacaggaacgattttagaagtcgttttgaggtaatggtcaaggctgaagcg
caacagcgtattgctattttgtttatagacattgacttatttaaacggattaatgatgca
cttggtcattacgttggtgacactgtcattaaagagacatcaaagaaattaaaagaaaat
atacctccagatgcgatcgttggtcggtggggcggagacgaatttatcgttgcactaccg
tttgaagaagagagggaggttgtaacactttctaaacagctattacttgatatagcaaga
cccatcgtaatgaagggatatacgtttgaaattacatctagtattggtattagtacagca
cctaatgatgcgaaggagccggaagaccttattcgacaagcagatatcgcgatgtatgaa
gcgaaaaggcacggtaaaaatcagtataggttttatcaagatgtggctaagtacgcatat
tttaatcattatgtatctcttgaaaatgatttaagatatgcgctacaaaataacgaattc
aatatttattaccaacctattatgaatgctgacggaaatgtattaggtgttgaagcatta
ttgcgttgggagaatcgtgataaaggaatgattccacctgataaatttattcctgttgct
gaagagctagggatgatgcctttcattggaaaatgggtactaaaggaaagtattcgacaa
gtgaaaaggtggcatgaattaggctatgaggatatttcattatctgtaaatgtctcaaaa
acacaattagtcagcaacgacttttgttcaattgttaaaacgactttagaagaatgtgat
tttccaccagaattacttgtgttagaaataacggaaagtgatgtcgctatttatatggaa
aaattaacgctcgcttcaaaagtattaacagaaatgggagtgaaaatctcactagacgat
tttggaatgggtgcttcttccttgcattacttaaaggaaatttttgttgatcaattaaag
attgatcgctcatttgtaaatggcatcccgtcagattccttcgatagtgcgctactttca
ggaatagtgacattatgtaaaaaattaaaaattgaagtagttgcagaaggcatagaaaca
gaggagcaatatatttatttaaaggaagacaacatctctctgcaaggttattactttagt
aagcctttaccgaaagatgaagtagagatgtttataattgaaaaaaataatagtatagaa
aacaggtga

DBGET integrated database retrieval system