KEGG   Bacillus cellulosilyticus: Bcell_0292Help
Entry
Bcell_0292        CDS       T01389                                 

Definition
(GenBank) sulphate transporter
  KO
K03321  
sulfate permease, SulP family
Organism
bco  Bacillus cellulosilyticus
Brite
Transporters [BR:bco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Bcell_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(315572..317035)
Genome map
AA seq 487 aa AA seqDB search
MNFTQKLKKEWLGNVRGDVLAGIVVALALIPEAIAFSIIAGVDPMVGLYASFCIAVVIAF
VGGRPGMISAATGAMALLMITLVADHGLEYLLAATILCGILQILFGVFKLATFMKFIPRS
VMVGFVNALAILIFTAQLQHFVDETWVMYALVALTLAIIYILPRFTKAVPSTLVAIIVVT
AIALIMNIGVRTVGDMGELTQTLPVFALPNIPLTFETLMIIFPYSLALAIVGLLESLLTA
SIVDDMTDTESNKNKESRGQGIANVITGCFGGMAGCAMIGQSVINVKSGGRGRLSALVAG
AFLMFLIIVLGNIVVQIPMAALAGVMIMVSIGTFDWRSLTNIHKIPRTDAAVMIVTVGTV
VYTHDLAQGVLAGVVLSAIFFAWKISKVKIKSVLSNDKLERTYYVEGQLFFASVTDFLDK
VNYNEDIEKVIIDVSKAHLWDDSAVGAIDKIEGKFEQKSIKVEIKGLNEESSVLLKKIGG
LSKASEH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgaattttacacaaaaactgaaaaaagaatggttaggaaatgttagaggagatgtatta
gcgggaattgttgtcgccctggcgcttattcctgaagctattgccttttctattattgca
ggagtagatcctatggtagggttatatgcttccttctgtattgcggttgtcatcgcattt
gttggaggacgccctggtatgatttctgctgccacaggtgctatggcattactcatgatc
acgcttgttgctgatcacggattagaatacttgcttgctgcaaccattttatgtggtata
ttgcaaattttatttggtgtgttcaaattagctacttttatgaagtttattccacgttcc
gtaatggttggctttgtcaatgcattagcaatcttaattttcacagctcaactacagcat
tttgtcgatgaaacgtgggtgatgtatgcccttgtcgccttaactttagcaatcatttat
attttacctagatttacaaaggctgttccttctactttagttgctatcatcgtcgtaact
gcgattgctttaataatgaacattggcgttcgaacagttggagatatgggtgaattaaca
caaacgttacctgtgtttgcattacctaatattccattaacctttgaaacattaatgatt
attttcccatactctttagctcttgctattgttgggttactcgagtccctattaacagca
tctattgtcgatgatatgacagatacagaaagtaacaaaaacaaagaaagccgtggacaa
ggtatcgccaacgttattactggttgttttggtgggatggctggttgtgcgatgattggc
caatccgtcatcaatgtaaagtctggaggtcgtggaagactttctgctttagttgcaggg
gcatttctcatgttccttatcattgtattaggaaatattgttgtccaaattccaatggcg
gctctcgctggtgtcatgatcatggtgtcaattggaacttttgattggagatcgttaacg
aacattcataaaattccacgtacagatgctgctgtcatgattgtgactgtcggaactgtc
gtttatacgcacgatttagcacaaggtgtgttagctggtgttgtattgagtgcgatattc
tttgcttggaaaatttctaaagtaaaaataaaaagtgtcttatctaacgataaattagaa
agaacgtattatgttgaaggtcaattattctttgcttctgttacagactttttggacaaa
gtaaattataatgaagatatagagaaggtaattatagatgtctcaaaagcacatctttgg
gatgattccgcagtaggagccatcgataaaatcgaaggtaaatttgagcaaaaatcgatt
aaggtagaaattaaaggattaaacgaagaaagctctgttttattgaaaaaaattggtggt
ttaagtaaagcatcagagcattaa

DBGET integrated database retrieval system