KEGG   Bacillus cellulosilyticus: Bcell_0294Help
Entry
Bcell_0294        CDS       T01389                                 

Definition
(GenBank) Spore coat protein X/V
  KO
K06342  
spore coat protein X
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
318335..318796
Genome map
AA seq 153 aa AA seqDB search
MNQEVYRSTDSKDKKWNALDPISKHPLCDTQDETQDAANKNKTLQLNEEYILIKDSCDVT
VNSTDTKAAVNLQIGLQAAIAVLISISVASSETAEKLTQELLQSSKVKQISRQQTIVENS
RNVDVSTTDTQAAVNIQILLQLLLALAVKLDIL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaggaagtatatcgctcaacagactcaaaagataaaaagtggaatgctttagat
ccaatcagtaagcacccgctttgtgatacgcaagatgaaacgcaagatgcagcgaacaaa
aataaaacattacagctcaatgaagaatatattttaattaaagattcatgtgatgtaaca
gtgaactcaactgatacgaaagcagcggttaaccttcagattggtctacaagctgcaatt
gcagttttaattagcatctcagtagcaagctcagagactgctgaaaagttaacacaagag
ctattacaatcatctaaagtgaagcaaatttctcgccagcaaacaatcgtagaaaactca
agaaatgttgatgtttcaactacagatacgcaagcagcagttaacattcaaattttacta
caactattattagcattagctgtgaagttagatatcctttaa

DBGET integrated database retrieval system