KEGG   Bacillus cellulosilyticus: Bcell_0297Help
Entry
Bcell_0297        CDS       T01389                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bco  Bacillus cellulosilyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcell_0297
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcell_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
319872..320762
Genome map
AA seq 296 aa AA seqDB search
MTEKPLITVIGSLNMDMVTTAKTMPREGETIHGESFKMVPGGKGANQAIAAARLGGHVQF
IGMVGDDPFGHHLIKVLKNEGIKRNEVKIVPNTSTGVATILLSENNNRIIVTEGANGYVT
KAYLEKLKERILESTIVLIQFEIPLEAIYYTLEICTQNNIQVVINPAPAKQLPTSMWKKA
TFITPNETELKELFTARAREHLGEKLIVTKGENGVVFKSHGEDIHIPSYPVEVVDTTGAG
DTFNGAFVVALTEGKSIKDSVNFANAAAALSIKKFGAQGGVPNRIKLDEFLNRLRP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaagccgttaattaccgtgattggtagtttaaatatggatatggtgacgacc
gcgaaaacaatgccaagggaaggggaaacgattcatggagagtcgtttaaaatggttcct
ggtggaaagggtgcaaaccaggccatcgctgctgcccgactaggtggtcatgtgcaattt
attggcatggtaggagatgatccgtttggtcaccatttaataaaggtgttaaaaaatgaa
gggatcaaacgtaatgaagtgaaaattgttccaaatacgagtacgggagttgcgacaata
ctactttccgaaaataacaatcgaattattgtaacagaaggagcaaacggctacgttact
aaagcgtatttagaaaaattgaaagagagaatactagagagcacgatcgttttaatacaa
tttgagattcctttagaagcgatatactacacgttagaaatatgcacacaaaataatatt
caagtggtcattaatccagcgccagcaaagcaactgccaacttcaatgtggaaaaaggca
acgtttattactccgaatgagacagaattgaaggagctgtttacagcaagagcaagggag
catttaggagagaaattgattgttactaagggggaaaatggggttgtatttaaaagtcat
ggagaagacatacatattccatcctatccagtagaagtagttgatacgacaggagcggga
gatacttttaacggtgcattcgtagttgccttaaccgaaggaaaaagtataaaagatagc
gtcaactttgcaaatgctgctgccgcactctcgataaaaaaatttggtgcgcaaggtggt
gtgccaaatagaataaaattagatgaatttttaaatcgcttaagaccatga

DBGET integrated database retrieval system