KEGG   Bacillus cellulosilyticus: Bcell_0299Help
Entry
Bcell_0299        CDS       T01389                                 

Definition
(GenBank) aminoglycoside/hydroxyurea antibiotic resistance kinase
  KO
K04343  
streptomycin 6-kinase [EC:2.7.1.72]
Organism
bco  Bacillus cellulosilyticus
Brite
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.72  streptomycin 6-kinase
     Bcell_0299
Antimicrobial resistance genes [BR:bco01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    Bcell_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
321460..322335
Genome map
AA seq 291 aa AA seqDB search
MDQSFQDIIVGVHGEKGKEWLTHFSTLKKEVEDRFEINIEETFKLSYNFVAKAVHRKTKA
PVVVKMGVPNEELTLEMLALQAFNGRGAISLIDKDDSLGAFLLPYIQGEQHGSLTNVEAT
IAVMKDLPIIEKQIDHFPTVHKLFQAFHKHRVRNGGTSGVIDPVIFHEAERMVDDLLSSE
KYRCLLHGDLHGGNIMHDRLQWIMLDPKGVAGEREFEPAQFFLNAPLDLLANSKVMDGWL
RKFESTLHLERNRVLAWAFCKGVLSSVWSIESNEQNWQWAIKRAEIIKSYM
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttggatcaatcgtttcaagacatcatcgtgggtgtccatggagaaaaagggaaggaatgg
cttacccatttttccaccctcaaaaaagaagttgaagataggtttgagataaatatagaa
gaaacatttaagctatcctataactttgtggcaaaagctgtacatagaaaaacgaaagcg
ccagttgtcgtgaaaatgggtgttccgaatgaagagttgacattggaaatgctagcgtta
caagcctttaacggaaggggagcgatttcgctaatcgacaaagatgattccttaggtgca
tttctattaccatatattcaaggggagcaacatggttcattaacaaatgtggaagcgacc
attgctgttatgaaagatcttcctattatagaaaaacagattgaccactttcctacagtg
cataaattgtttcaagcctttcataagcatagagtaagaaatggtggaacttctggcgtc
attgatccggttattttccatgaagcagaacgtatggtagacgaccttctttcatcagag
aaatatagatgtttattacatggagaccttcatggtgggaatattatgcatgatcggtta
cagtggatcatgcttgatccaaagggtgtagctggtgagcgggaatttgaaccggcacaa
tttttcttaaatgcaccattggatttattggctaatagtaaagtaatggacggatggtta
cgtaaatttgagagtactcttcatttagagcgtaatagagttctcgcctgggcattttgt
aaaggggttttatcaagtgtatggtccatagagagcaatgaacagaattggcaatgggct
ataaaaagagcagaaatcattaaaagttatatgtga

DBGET integrated database retrieval system