KEGG   Bacillus cellulosilyticus: Bcell_0306Help
Entry
Bcell_0306        CDS       T01389                                 

Definition
(GenBank) choline/carnitine/betaine transporter
  KO
K05020  
glycine betaine transporter
Organism
bco  Bacillus cellulosilyticus
Brite
Transporters [BR:bco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Bcell_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(326832..328640)
Genome map
AA seq 602 aa AA seqDB search
MDNNKFEYETKKTNIVFFISAPIVALFVLWGFIAPGHLERVSNDALALTLNNFGWFYMLC
TAFFIVFVLFLAISPFGKLRLGKPDERPEYKFYTWLGMLFSAGIGVGFVFWGVAEPALYF
LDPHPDYVDAADQYKAAAGLRYAVFHWALHPWAIFSLVALTLAYVQFRKDQPALISSAFQ
PILGDRIYGPLGKGIDVLAVLATSTGVATTFGLSALQITGGLSHLTGTIPNNPATQLTVI
AIVTVLFIFSAATGVNKGIRILSTINLTVAGLLLVFVIIFGPTLFIAESVVSTIGGYIAN
VTQMSLDLNPFGDGEWLGMYTIFFWAWHISWAPFMGIFIARISRGRTIREFVAGVLIVPS
LLAVIWFTAFGGTALDMIMGGNDHIANLVLENVEVALFVTLNELPLGMIMSGLAVILIII
FFITSADSASYVLAALSSEGSLDPKLWVKVVWGFLIASTASVLLVSGGLSGLQTASIVAA
LPFAIIMVIMIFSLLMMMSRDTRAEQLWTRRKRTRKIKKEVHSEMYDRVKDNMLDDMKED
VYEEIKEEVYEQVKEEVYDDIKEEVYEEFKEKIYDDLREDLSEQLNGELEERMDDSDDKK
KE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
ttggacaataacaaatttgagtatgaaacgaagaaaacgaatattgtattttttatatcc
gctccaattgtcgcccttttcgttttatgggggtttatcgcacctgggcatttagagagg
gtatctaacgacgctttagctttaactttgaataacttcggctggttttatatgttatgt
actgccttttttattgtatttgttttatttttagctattagtccgtttggtaaactccgc
ttagggaagcctgacgaaaggccagaatataaattttatacttggctaggtatgcttttt
tctgcaggtattggtgtggggtttgtattttggggcgttgctgagcctgctttatatttc
ttagatccacatccagattatgttgatgctgcagatcagtataaagccgctgctgggctt
cgatatgctgtatttcactgggcgctgcatccgtgggcgattttctcattagttgcatta
acacttgcctacgttcagttcagaaaagatcaaccggccttaattagctctgcctttcaa
ccaatattaggagatcgtatttatggtccattaggaaaagggattgacgtattagctgtt
ttagctacctctacaggggttgctacaacattcggattaagtgcgttgcaaattaccggg
ggattatctcacttaacaggtacgattccgaataatcctgcaactcaacttaccgttata
gctattgtgacagtactatttattttttcagctgcaacaggtgttaataaaggcatacga
attttaagtacgatcaacttaactgtcgcagggctattacttgtttttgtgattattttt
ggaccaacgctgtttattgcggaaagtgtcgtatcgacaataggcggatatatcgccaat
gtcacacaaatgagtcttgacttaaatccatttggtgacggagaatggctcgggatgtat
acgatctttttctgggcttggcacatttcgtgggcaccatttatgggtatttttatcgcc
cgtatctcacgtggaagaacgattcgcgaatttgttgctggggtgcttatcgttccttca
ttattagcggtcatttggtttacggcctttggtgggaccgccttagacatgattatgggt
ggaaatgatcatatcgcaaaccttgtgttggaaaatgttgaggttgccctgtttgttaca
ctcaatgaactgccacttgggatgataatgagtggattagcggttattttaatcatcatt
ttctttatcacatcagcagactctgcatcgtatgtgttagccgctttatctagtgaaggt
agtcttgatccaaagctatgggtaaaagtcgtttggggctttctgatcgcttcaacagca
agtgtgttgttagtaagtggaggattatcaggactgcaaaccgcttcgattgtcgccgcg
ctcccctttgccattatcatggtcattatgatcttctcgttactcatgatgatgagtaga
gatacgagagcggaacagctatggacgcgacggaagcgcacgagaaaaataaagaaggaa
gttcatagcgaaatgtacgatagagtaaaagacaatatgctcgatgacatgaaagaggac
gtttacgaggaaattaaggaagaagtatacgaacaagtgaaagaagaagtatacgacgac
attaaagaagaagtgtatgaagagtttaaggaaaaaatttatgatgatttacgcgaagat
ttaagtgaacagctaaatggagagttggaagaaagaatggacgactcggacgataagaaa
aaggagtag

DBGET integrated database retrieval system