KEGG   Bacillus cellulosilyticus: Bcell_0307Help
Entry
Bcell_0307        CDS       T01389                                 

Definition
(GenBank) NADPH-dependent FMN reductase
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(329075..329629)
Genome map
AA seq 184 aa AA seqDB search
MTNDSTIVMINGSMSSDSFTKKLLENVEDRLNKNGQNTTMIDVRELHLEIYDPDAPFPTQ
LEPVREQLREADGVIVGAPEYHGSYTGAIKNFLDYLGFKEFEQTPIALLTTTGGLKAGTN
TLNHLRLVFRNLHGIVIPQQFAISNKEAPTSLEFDENINARLEAFVNAIQKEVVKKQLYE
EWKR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgatagcacgatcgtaatgattaatggtagtatgagcagtgactcgttcaca
aaaaagctattagaaaatgtagaagaccgcttaaataaaaatggacaaaatactacaatg
attgacgtaagagagttacatctagaaatctacgatcctgatgctccttttccaacacaa
ctagagccagtacgtgaacagctaagagaggctgatggcgtcattgtcggtgctccagag
tatcacggctcctatacaggtgccattaaaaattttttggattacctcggctttaaagag
tttgaacaaacacctatcgcactactaacgactaccggagggttaaaggcaggtacaaat
acacttaatcacttgaggcttgttttcagaaatttgcatggtattgtcataccacagcaa
tttgctatcagtaacaaagaagcgccaacaagtttggaatttgatgaaaatataaacgct
cgtcttgaagcctttgtgaacgccattcaaaaagaagtagtaaaaaaacagctttatgaa
gaatggaagcgttaa

DBGET integrated database retrieval system