KEGG   Bacillus cellulosilyticus: Bcell_0308Help
Entry
Bcell_0308        CDS       T01389                                 

Definition
(GenBank) export-related chaperone CsaA
  KO
K06878  
tRNA-binding protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
329911..330243
Genome map
AA seq 110 aa AA seqDB search
MATFDDFLKLDMRVGTVLESEEFLEARVPAIKLKIDFGEEIGIKQSSAQITKRYEPEALI
GRQIVAVVNFPPLRIAGFKSEVLVMGGVPEKGDVILLNVDESVPNGTKIS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttttgatgattttttaaagcttgatatgagagtagggactgtattagagtcg
gaggagtttttagaggcgcgagttccagcgataaaactaaaaatcgactttggagaggaa
ataggtattaaacagtcaagtgcacaaattacgaaaagatatgagcctgaagcacttatc
gggagacaaatcgttgcagttgtcaacttccctccgttaagaatagcaggctttaaatca
gaagtactcgtcatggggggagttccagaaaaaggggatgttattttactaaacgtcgat
gaaagcgtgccaaacggtacaaaaatatcgtag

DBGET integrated database retrieval system