KEGG   Bacillus cellulosilyticus: Bcell_0422Help
Entry
Bcell_0422        CDS       T01389                                 

Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
bco  Bacillus cellulosilyticus
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bcell_0422
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Bcell_0422
Enzymes [BR:bco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Bcell_0422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
456636..457214
Genome map
AA seq 192 aa AA seqDB search
MNLGVFASGSGSNFEAIMEAVKSGAVAGKVQLLVCDKEDAYAIKRAENHGVPVFTYQPKV
FASKEAYETEILRQLQAYNVELIVLAGYMRLIGSTLLSAFEHRIVNIHPSLLPAFPGLDA
IGQAFDAKVKVSGVTVHYVDAGMDTGPIIAQEAIHIEDGDTKEDVQRKIQQVEHQLYPKT
IQGVIEQITRGV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcggagtgtttgcttctggaagtggaagtaactttgaagcgataatggaagca
gtaaagagtggggcagttgccgggaaagtacagcttctcgtttgtgataaggaggatgct
tatgccattaagcgtgctgaaaatcacggtgtacctgttttcacataccaaccaaaagta
ttcgcttcaaaggaagcatatgaaacagaaattttaaggcagcttcaagcatataacgtt
gagttgattgttttagcaggctatatgaggctgattggctccacgttactgtctgccttt
gaacatagaatagtcaacattcatccttcgttattacccgcattccctggattagatgct
atcggacaggcatttgatgcaaaggtaaaggttagtggtgtaacggtgcattatgtagat
gcgggtatggatactggtccgatcatcgcccaagaggcgattcacatagaagatggagat
acgaaagaggacgtacaacgaaaaatccagcaagttgagcatcaactgtatccgaaaacg
atacaaggtgttatcgaacaaataacaaggggcgtgtaa

DBGET integrated database retrieval system