KEGG   Bacillus cellulosilyticus: Bcell_0516Help
Entry
Bcell_0516        CDS       T01389                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcell_0516
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_0516
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcell_0516
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcell_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
578159..579325
Genome map
AA seq 388 aa AA seqDB search
MSMREDEKRGYFGEFGGSFIPEELQKVMDILEENFENYRNDPEFIEEYKYYLKEFVGREN
PLTYAKNISEKFGGAKIYLKREDLNHTGAHKINNVIGQILLAKRMGAKRIIAETGAGQHG
VATATACAMFNMDCTVYMGKLDTERQALNVFRMELLGAKVISVDAGQGRLKDAVDAALGD
LVENYENTFYLLGSAVGPHPFPSMVKHFQSIISEESKQQILEKEGKLPTAVVACAGGGSN
AIGAFAHYIDEKDVRLIGVEPAEAPTLTEGVPAVIHGFKCLTLLDEDGNPRPTYSISAGL
DYPGIGPEHSYLKESGRAEYVAVTGDEALEAFQLLSKEEGIIPALESSHAIAHAVKLAKE
LSKDDILIVNLSGRGDKDVEQVFKMINQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgagagaagacgagaagagaggttattttggtgagtttggtggtagttttatt
cctgaagagcttcaaaaggtcatggacattttggaagaaaactttgagaattaccgaaac
gatcccgaattcattgaggaatacaaatactacttaaaggaatttgtaggtagagaaaat
cctttaacttatgccaaaaatatatcagaaaagtttggtggagcaaaaatttatttaaag
cgcgaggacttaaatcatactggcgcacacaagattaataatgttatagggcaaatactt
cttgcaaaacgtatgggtgccaaaagaatcatcgctgaaacaggtgccggacagcatggt
gtagcaacagccacagcgtgcgcgatgtttaatatggattgtacggtatatatgggtaag
ttagacacggagcgacaagcattaaatgtgtttcgaatggaattacttggtgcgaaggtc
atttcagttgatgcaggacaaggtagattaaaagatgctgttgatgctgcattaggtgac
cttgttgaaaactatgaaaatacattttatttactaggctcagccgttggtccacatccg
ttcccatcgatggtaaagcattttcaatcaattattagtgaagagtcaaagcaacaaatt
cttgaaaaagaaggaaagctccctacagctgtcgtagcatgtgctggaggaggaagcaac
gcaattggtgctttcgctcattatatagacgaaaaggacgtacgtcttataggggtagaa
ccagcagaagcgcctactttaacagaaggtgttccagctgtcattcatggctttaagtgc
ttaacgttgttagatgaagacggaaaccctaggccaacatattctatctctgctggatta
gattatccaggaattggtccagagcatagttatttaaaggaatctggacgtgccgaatat
gttgcagtaacaggcgacgaagcactagaggcgtttcagcttctatcaaaagaggaaggg
attatccctgctttggaaagctctcatgcaatagcgcatgcagttaagctagcaaaagag
ctatcaaaagatgatatccttatcgttaatttatccggtcgtggcgataaagacgtagag
caagtatttaagatgattaatcaataa

DBGET integrated database retrieval system