KEGG   Bacillus cellulosilyticus: Bcell_0516Help
Entry
Bcell_0516        CDS       T01389                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcell_0516
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_0516
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcell_0516
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcell_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
578159..579325
Genome map
AA seq 388 aa AA seqDB search
MSMREDEKRGYFGEFGGSFIPEELQKVMDILEENFENYRNDPEFIEEYKYYLKEFVGREN
PLTYAKNISEKFGGAKIYLKREDLNHTGAHKINNVIGQILLAKRMGAKRIIAETGAGQHG
VATATACAMFNMDCTVYMGKLDTERQALNVFRMELLGAKVISVDAGQGRLKDAVDAALGD
LVENYENTFYLLGSAVGPHPFPSMVKHFQSIISEESKQQILEKEGKLPTAVVACAGGGSN
AIGAFAHYIDEKDVRLIGVEPAEAPTLTEGVPAVIHGFKCLTLLDEDGNPRPTYSISAGL
DYPGIGPEHSYLKESGRAEYVAVTGDEALEAFQLLSKEEGIIPALESSHAIAHAVKLAKE
LSKDDILIVNLSGRGDKDVEQVFKMINQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgagagaagacgagaagagaggttattttggtgagtttggtggtagttttatt
cctgaagagcttcaaaaggtcatggacattttggaagaaaactttgagaattaccgaaac
gatcccgaattcattgaggaatacaaatactacttaaaggaatttgtaggtagagaaaat
cctttaacttatgccaaaaatatatcagaaaagtttggtggagcaaaaatttatttaaag
cgcgaggacttaaatcatactggcgcacacaagattaataatgttatagggcaaatactt
cttgcaaaacgtatgggtgccaaaagaatcatcgctgaaacaggtgccggacagcatggt
gtagcaacagccacagcgtgcgcgatgtttaatatggattgtacggtatatatgggtaag
ttagacacggagcgacaagcattaaatgtgtttcgaatggaattacttggtgcgaaggtc
atttcagttgatgcaggacaaggtagattaaaagatgctgttgatgctgcattaggtgac
cttgttgaaaactatgaaaatacattttatttactaggctcagccgttggtccacatccg
ttcccatcgatggtaaagcattttcaatcaattattagtgaagagtcaaagcaacaaatt
cttgaaaaagaaggaaagctccctacagctgtcgtagcatgtgctggaggaggaagcaac
gcaattggtgctttcgctcattatatagacgaaaaggacgtacgtcttataggggtagaa
ccagcagaagcgcctactttaacagaaggtgttccagctgtcattcatggctttaagtgc
ttaacgttgttagatgaagacggaaaccctaggccaacatattctatctctgctggatta
gattatccaggaattggtccagagcatagttatttaaaggaatctggacgtgccgaatat
gttgcagtaacaggcgacgaagcactagaggcgtttcagcttctatcaaaagaggaaggg
attatccctgctttggaaagctctcatgcaatagcgcatgcagttaagctagcaaaagag
ctatcaaaagatgatatccttatcgttaatttatccggtcgtggcgataaagacgtagag
caagtatttaagatgattaatcaataa

DBGET integrated database retrieval system