KEGG   Bacillus cellulosilyticus: Bcell_0541Help
Entry
Bcell_0541        CDS       T01389                                 

Definition
LPXTG-motif cell wall anchor domain-containing protein (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bco  Bacillus cellulosilyticus
Brite
Enzymes [BR:bco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Bcell_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
610559..614059
Genome map
AA seq 1166 aa AA seqDB search
MKRRHVKLFFIQLLVILLVLPPGIMTAQSSVEAIGSFEREIIAEYHFDDGTTQGWFGREA
NLEVVDNEAHSGEYSLFVDGRTEGWNSPALDLQGMLEIGATYEIAGYMKRAEATSEEKLV
MAMIDQSVGEDAQYNWINSRETSQTDWVELRGEYTITDEKEDLVLYFEIENNTENFYIDS
ISITKISPADDSFVPEIVAEFDFEDGTTQGWFGRGITPKVVQGNGQSGEHSIFVEGRTEN
WHSPALNVRELFEIGATYEITGHMKRATTTEEDGNLVMAMIDQSIGGDANYNWIDNKRVT
HDNWVALSGEYSITEEKGELTLYFEIEGNTEDFYINTITITMISPPTETGDDDIIDVPVE
ERVAAFTDFEDGTTQGWEPREGPEELTVTTDTAKNGERSLLISNRQGSFHSAKLDFLDHM
YAGHTYDISVWVKLAPGETPTSLQISRAETISGSTNYYPPVINPTEVTADEWVLLQGTYT
LTGNVSDLYFYVEEPYDENQETGVSFYIDDFKAEVRVPDELEDIAPLKDVFADHFDIGAA
VEPRHTAGQHGKMLEKHYNMLVAENIMKPESIQPTEGEFNWVNADAMFDYAEENGLKVRF
HTLVWHSQSPSWMFLDANGDPMVVDGVVADPDNLEANKALLLQRIEDHVHAVVGRYGDRV
DSWDVVNEVIVPTEEDGFRKSEYYLITGTEFIHKAFEATAEALAALGDDVHPNAKLYYND
YNTHNPQKREFIYEMVKEMQNEGIPIDGIGHQTHLNINSSIELVIASIERFTELGLDNQI
TELDISIYTGNNEAFFSYADIPASKHEEVAMAYGELFKQLRGVSDQVSSVVFWGIADDHT
WLHGRGVANRVDAPFVFDQDLKAKEAYYTVIDDNYVAPERPSIPEPKSEIAYYGTPTING
ELDDIWQIATVFETDTWVEGESGSTASVRALWDDEYLYVFAEVTDSQLSNVSNNEWEQDS
VEIFVDQNNEKTNYYQLDDGQFRVNFENEVSINGFGSDTFRSATAITEEGYIVEAAIKLE
AIEPVEGTVIGFDIQVNNDENGDGVRNSVVTWNDPTGESYQSTSQFGELQFVLEPETDQE
KPVDDPLKPGDQERKPSTPGEEDSLVIGGEGGSERQHETEEGSKGDELPRTATNNYNMIA
LGSLLLLLGTTILIVFRRKNKVTIRE
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaggcatgtaaaactattttttattcagttactcgtaattttgttagttttg
ccaccaggaataatgacagcacaatcttctgtagaagcaattggcagctttgaacgagag
attattgcagaatatcactttgatgatggaacgacgcaagggtggtttgggagagaagca
aatcttgaagtcgtggacaacgaagcacattctggagagtatagccttttcgtggatgga
agaactgaggggtggaatagtccggcgttagacttacaaggaatgctcgaaattggggct
acatatgagatagctggctatatgaaacgcgctgaggcaacatctgaagaaaagcttgtt
atggcaatgattgatcaatctgttggagaagatgcgcaatacaactggattaatagtaga
gaaacctctcagactgattgggtagagttaagaggggaatacacgataacagatgaaaaa
gaagacctagtattatattttgaaatagaaaacaacacggaaaacttttatatcgattct
atttctattacgaaaatttctccggcagatgatagcttcgttccagagattgtagccgaa
tttgattttgaggatggaacgacacaaggctggtttggtagagggataacaccgaaagta
gtacagggaaatgggcaatcaggagagcacagcatcttcgttgaaggtagaacagaaaat
tggcatagtcccgcactgaatgtgagagagctgtttgaaattggtgctacgtatgaaata
acaggtcacatgaagcgtgcaactactactgaagaagatgggaatttggtaatggcaatg
attgatcaatctattggtggggatgcaaattacaattggattgataacaaaagagtgacg
catgataactgggtggcgttatcgggtgaatattctattactgaggaaaagggagagtta
actctttattttgaaatagaaggtaacaccgaagatttttatattaatacgattacaatt
acgatgatatcaccgccaacagaaacgggcgatgatgacatcattgacgtgcccgttgag
gaaagggttgctgcattcacggattttgaggatggtacaactcaagggtgggagccgaga
gaaggcccagaggaattgaccgtaacgacagatacagcaaaaaatggggaaagaagctta
ctaatatctaatcgtcaaggctcctttcacagtgcgaagctcgatttcctcgatcatatg
tatgcaggccatacgtacgacattagcgtatgggtgaaattagcaccaggggaaacgcct
acgagcttacaaatatctcgagcagaaactatttctggctctacaaattattatccacca
gtaattaacccaactgaagtaacagcggatgaatgggtattgctacaaggaacatataca
ttaactggaaacgtaagcgatttgtatttctatgtcgaagagccttatgacgaaaatcaa
gagacaggcgtatcgttttatatagatgactttaaggcagaggttagggttcctgatgag
ctagaagatatagcaccgttaaaagacgtatttgcagatcattttgacattggtgcagca
gttgaaccacgccatacagctggtcagcacggaaaaatgctggaaaagcattataacatg
ctcgttgcagaaaatattatgaagccagagtcaatacagccaacagagggtgaatttaac
tgggtgaatgcagatgcaatgtttgattatgctgaagaaaacggattaaaggttcgtttt
catacactcgtatggcatagtcaatcaccaagctggatgtttctagatgctaatggagat
ccaatggttgttgatggtgtagtagctgaccctgataatctagaagcaaataaggcgttg
ctgcttcaaagaatagaagatcatgtccatgctgtagttggaaggtatggagatcgtgtt
gattcgtgggatgttgtgaacgaagtcattgttcctactgaagaggatggtttcagaaaa
agtgaatattatttaattacgggtacagagttcattcataaagcttttgaagcgactgca
gaagcattagcagcacttggggatgatgtccatccaaatgcaaagctatactacaacgat
tacaacacacacaatccgcagaaaagagaattcatttacgagatggtcaaggagatgcaa
aacgaaggaattcctattgatggtatagggcatcaaacacatttaaatataaactcttcg
atagagcttgtcatagcatctattgaacgatttactgagcttggattagataatcaaatt
acagagctagatattagtatttacaccggtaataatgaagcgtttttcagttatgctgac
atacctgcatctaagcacgaagaagtggcgatggcgtacggagagcttttcaaacagtta
agaggtgtgagtgatcaagtgagcagtgttgtcttttggggaatagcggacgaccatact
tggctacacggcagaggagtcgccaaccgtgtcgatgcaccatttgtttttgatcaggat
ttaaaggcgaaagaagcttactatactgtcattgatgataattatgttgctccagaaaga
ccatcgataccggagcctaaatcagaaattgcttattatggtacaccaacaatcaatggc
gaactagatgatatttggcaaatagctactgtcttcgagacggatacttgggttgaaggt
gagagtggctctaccgctagcgtaagagcattgtgggacgatgaatatttatatgttttc
gctgaagtgacagatagtcaattaagcaatgtaagtaataatgaatgggagcaagattca
gtagaaattttcgttgaccaaaataatgaaaaaacaaattattatcagcttgatgatgga
caattccgtgtcaactttgagaatgaagtgagcattaatgggtttgggtccgatacattt
agaagtgctacagcaataacggaagaaggatatattgtagaagcagcaataaagctagaa
gcgatcgaaccagttgaaggtactgttatcggctttgatattcaagtaaacaacgatgaa
aatggagacggagtaagaaatagtgtagtgacatggaatgatccgacaggtgaatcatat
caaagcacatctcagttcggtgaattacaattcgttcttgagccagaaacggatcaagag
aaaccagtggatgatccattaaaaccaggtgatcaagaacgaaaaccaagtaccccagga
gaagaggatagcctagtaatagggggagagggtggctctgaaagacaacacgaaacagaa
gaaggaagtaaaggtgatgagcttcctagaacagcaacgaataattacaatatgatcgcg
cttggttcgttgttactactgcttggaacaacaattcttattgtgtttagaaggaaaaat
aaggtgactatacgagagtaa

DBGET integrated database retrieval system