KEGG   Bacillus cellulosilyticus: Bcell_0551Help
Entry
Bcell_0551        CDS       T01389                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bco  Bacillus cellulosilyticus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcell_0551
   00051 Fructose and mannose metabolism
    Bcell_0551
Enzymes [BR:bco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Bcell_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
627528..628853
Genome map
AA seq 441 aa AA seqDB search
MSYFKNVQQVKFEGSQSSNPFAYKYYNPEEKINGKSMEELLRFAVSYWHTFTGEGTDPFG
AGTAVRPYNHLSGMDLAKARVEASFEFFEKLDVPFFCFHDIDVAPESDSLSETLKNIDEI
VAMIKDYLKTSKVKLLWNTANMFTHPRWLHGAATAPNADIFAYAAAKVKKGLEVGKELGA
ENYVFWGGREGYETLLNTDMGLELDNLARFFHMAKDYAKEIGFDAQFLIEPKPKEPTKHQ
YDFDVATGLAFLQKYDLQDTFKFNIEANHATLAGHTFEHELRTARVNGMLGSVDANQGDT
LLGWDTDEFPTDLYSTTLAMYEILKNDGLGSGGLNFDAKVRRPSFDTDDLFHAHIAGMDA
FAIGTKVAQRLIEDKVLDDFVADRYKSYTEGIGLDIVEGKTDFHKLEKHALSLTEINNKS
GRQELLKATINKYLLETFAQK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagttattttaaaaatgttcagcaagtaaagtttgaaggttctcaatctagcaatcca
ttcgcttataaatattataatcctgaagaaaaaattaacggaaaatcaatggaagagctt
cttcgttttgcagtgtcttattggcacacatttacaggggaaggaacggatccattcgga
gctgggacagcagttagaccatacaaccacttatctggaatggaccttgcaaaagcacgt
gtagaagcatcgtttgaattttttgaaaagctagatgttcctttcttctgcttccatgat
attgatgttgctcctgaatctgattctttaagtgagacgctgaaaaacattgatgaaatt
gttgcaatgataaaagactatctgaaaacaagcaaagtaaagttgctttggaatactgct
aatatgtttacacatccgcgttggttacacggtgctgcaacggcacctaacgctgacatc
ttcgcttatgctgctgcaaaagtaaaaaaaggcttagaagttggtaaagagcttggtgcg
gaaaactatgtattttggggtggacgtgaaggatatgaaacgctcctaaatacagatatg
ggtcttgaactagataatctagcacgctttttccatatggcaaaagattatgcgaaagaa
attggttttgatgcacaatttttaattgaaccaaagccaaaagagccaacaaagcaccaa
tatgattttgatgttgcaacaggcttagcgtttttacaaaaatatgatctgcaagatacg
tttaaatttaatattgaggcaaaccatgcaactttagctggccatactttcgagcacgag
ctaagaacagcacgcgtaaatggtatgttaggctctgttgatgcaaaccaaggtgataca
ttacttggatgggatacagatgagttcccgactgatctatattctacaacattagcaatg
tatgaaatattgaaaaatgatggacttggtagtggaggcttaaacttcgatgcgaaggta
agacgaccttcttttgatacagacgacttattccacgcgcatatcgctggtatggatgct
tttgcaatcggtacaaaagtagcacaacgcttaattgaggataaagtattagatgacttc
gtagctgatcgctacaaaagctacacagaaggaataggcctagatattgttgaaggcaag
acagacttccacaaattagagaagcacgcgctaagtttaactgaaattaacaataagtct
ggaagacaagagttgttaaaggcaacaataaacaaatatttattagaaacatttgctcaa
aaataa

DBGET integrated database retrieval system