KEGG   Bacillus cellulosilyticus: Bcell_0566Help
Entry
Bcell_0566        CDS       T01389                                 

Definition
(GenBank) Cellulase
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
645536..646606
Genome map
AA seq 356 aa AA seqDB search
MQKLLEQLTALHGPCGYEQPVSEWIRDTIQPFVDEVTIDPLGNVIGTKKGSKPGPKVIMT
AHMDEIGFIVKKIEKNGLIRFEKLGGHDDRILLTQKVQVRTKSSYLTGVIGSISAHYAKF
DDATKVRNHRQLYIDIGAKNVEDAKRLGVTVGAPITWLPSIDYLGDDSTGRFVGKGFDDR
AGCAVIIKTLQELEGKSFSGEVSAIFTVQEEVGLRGAQVATRQVDADVGIAIDTTAVSDT
PEETMDQTLALGAGTGIKVLDMSLISHPTVKEYLIDLAEEKQIPYQLEVFPGIGTDGGAM
SLTNRGIPTGVLSIPSRYAHSPVEVIDINDLHATKNLLKEFILSLSEQSQFPFIKK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaaattactagagcagttaacggctttacatgggccatgcggatacgagcaacca
gtaagtgaatggataagagatacgatacaacctttcgttgacgaggtgactattgatcca
ttaggaaatgttattggtacaaaaaaagggagtaaacctggtccaaaggtgatcatgacg
gcgcatatggatgaaattggttttatcgttaaaaagattgagaaaaatgggttgattcgc
tttgaaaagctaggtggacatgatgaccgtattttacttacacaaaaagtacaggtacgt
acaaaatctagttatttgactggagtgataggtagtatttcggcacattacgcaaaattt
gatgatgctactaaggttcgcaatcatcgtcagctatatattgatattggtgctaaaaat
gttgaagacgccaaaaggttaggcgttacggtcggtgcacctattacatggctaccgagt
atagattaccttggagatgattcgactggtcgtttcgtggggaaaggatttgatgataga
gcaggctgtgcggtcattattaaaacattgcaagagctagaagggaaaagtttttcaggt
gaggtatcagctatatttaccgttcaagaggaagttggcttaagaggtgcacaggttgca
actcgccaagttgatgctgatgttgggatagctattgacacaacggctgtcagtgacaca
ccggaagagacgatggatcaaacgctagcactgggagcgggtacaggaattaaagtgctt
gatatgagtttgatttctcatccaactgtgaaagagtatttaatcgatttggcggaggaa
aaacaaattccgtatcagcttgaagtttttcccggtattggaacagatggtggagcaatg
agtttaacaaataggggcattccaactggggttttatcgataccttctagatacgctcat
tctccagtagaagtaatagacataaatgaccttcatgctactaaaaatctattaaaagaa
tttattttatcattgtctgagcagtcacagtttccgtttataaaaaaataa

DBGET integrated database retrieval system