KEGG   Bacillus cellulosilyticus: Bcell_0689Help
Entry
Bcell_0689        CDS       T01389                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00511  Other glycan degradation
bco00600  Sphingolipid metabolism
bco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bcell_0689
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bcell_0689
Enzymes [BR:bco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Bcell_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Melibiase_2_C
Motif
Other DBs
NCBI-ProteinID: ADU28971
UniProt: E6TZA9
Position
788742..790079
Genome map
AA seq 445 aa AA seqDB search
MRKSIQVIQTSKYDTGKWNNKGNFDLLQGKSDTDNTIDIYPEDEYQEWLGFGGAFTEAAA
YSLSKVSKENQKEIIYHYFNKEHGLGYTLGRTHIHSCDFSLENYTYVEENDEKLQTFSID
REKKLVIPLIKAAIKEAGEELSILSSPWSPPAWMKTNGDMNHGGKLKEKYRDLWALYYVK
YIQEMSKEGINIWGVSVQNEPEATQVWDSCRYTAEEERDFVKFHLGPTLEKHGFDNKKIV
IWDHNRDLMVERAEKILSDPEAAKYIWGVGNHWYVSEEFENLSKVHEMFPNKHLIFTEGC
IEGGVQLGAWHTGERYARNIIGDMNNWLEAFLDWNIVLDEKGGPNHVGNYCDSPVIVDTN
EDVVHYNSSFYYIGHFSKYIKPGAKRIATNSKIETLSYTAFKNSDGSIALVVLNETEQDI
PYTLQIEGKYINLISTKRSINTILI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagtattcaagtaatacaaacttctaaatacgatactggtaaatggaataac
aagggtaattttgacttacttcaagggaaaagtgatacggataatacgatcgatatatat
ccagaggatgaatatcaagaatggttgggctttgggggagcttttacagaagcagcagcg
tatagcttatctaaagtttcgaaggaaaatcaaaaggaaattatttatcattactttaat
aaggaacatggactagggtatacgttaggaagaacacatattcatagctgtgatttttca
ctagaaaattatacatacgttgaagaaaatgatgaaaaattgcaaaccttttccattgat
cgagaaaaaaaattagtaatccctcttataaaggctgcgataaaagaggcgggggaagaa
ctaagcattctttcatcaccatggagtccacctgcatggatgaaaaccaatggagatatg
aatcacggcggaaagctgaaggagaagtatcgtgacctttgggctttatattatgtgaaa
tatattcaggaaatgagtaaagaaggaattaatatttggggtgtatctgtacaaaatgaa
ccagaagcgacccaagtatgggattcatgtagatataccgctgaagaagaacgtgatttt
gttaaattccatttagggccaacacttgaaaaacacggttttgataacaaaaaaattgtt
atatgggatcataatcgagacttaatggtcgagcgtgcggaaaagatactatctgatcct
gaagcggcaaaatatatttggggtgtaggaaatcattggtatgtttcagaggaatttgag
aatctatcgaaagttcatgaaatgttcccaaataaacacctcatctttactgaaggttgt
atagaaggaggcgtacaattaggagcttggcatacaggagaacggtatgcaagaaatatc
ataggagatatgaataattggctagaagctttcctagattggaatatagtcttggatgaa
aagggcggcccaaaccatgttgggaattattgtgattccccagttatcgttgatacaaat
gaggatgtcgttcactataatagttcattttattatattggtcactttagtaaatatatt
aaaccgggtgcaaaacgaatagcaactaattcaaagatagagacgttatcgtacactgca
tttaaaaatagtgatggaagtattgcattagtagtcttaaatgaaacagagcaggatatc
ccttatacattgcaaatagaagggaaatatatcaacttaatatcaactaaaagatccatt
aatactatattaatttaa

DBGET integrated database retrieval system