KEGG   Bacillus cellulosilyticus: Bcell_0689Help
Entry
Bcell_0689        CDS       T01389                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bco  Bacillus cellulosilyticus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bcell_0689
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bcell_0689
Enzymes [BR:bco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Bcell_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
788742..790079
Genome map
AA seq 445 aa AA seqDB search
MRKSIQVIQTSKYDTGKWNNKGNFDLLQGKSDTDNTIDIYPEDEYQEWLGFGGAFTEAAA
YSLSKVSKENQKEIIYHYFNKEHGLGYTLGRTHIHSCDFSLENYTYVEENDEKLQTFSID
REKKLVIPLIKAAIKEAGEELSILSSPWSPPAWMKTNGDMNHGGKLKEKYRDLWALYYVK
YIQEMSKEGINIWGVSVQNEPEATQVWDSCRYTAEEERDFVKFHLGPTLEKHGFDNKKIV
IWDHNRDLMVERAEKILSDPEAAKYIWGVGNHWYVSEEFENLSKVHEMFPNKHLIFTEGC
IEGGVQLGAWHTGERYARNIIGDMNNWLEAFLDWNIVLDEKGGPNHVGNYCDSPVIVDTN
EDVVHYNSSFYYIGHFSKYIKPGAKRIATNSKIETLSYTAFKNSDGSIALVVLNETEQDI
PYTLQIEGKYINLISTKRSINTILI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagtattcaagtaatacaaacttctaaatacgatactggtaaatggaataac
aagggtaattttgacttacttcaagggaaaagtgatacggataatacgatcgatatatat
ccagaggatgaatatcaagaatggttgggctttgggggagcttttacagaagcagcagcg
tatagcttatctaaagtttcgaaggaaaatcaaaaggaaattatttatcattactttaat
aaggaacatggactagggtatacgttaggaagaacacatattcatagctgtgatttttca
ctagaaaattatacatacgttgaagaaaatgatgaaaaattgcaaaccttttccattgat
cgagaaaaaaaattagtaatccctcttataaaggctgcgataaaagaggcgggggaagaa
ctaagcattctttcatcaccatggagtccacctgcatggatgaaaaccaatggagatatg
aatcacggcggaaagctgaaggagaagtatcgtgacctttgggctttatattatgtgaaa
tatattcaggaaatgagtaaagaaggaattaatatttggggtgtatctgtacaaaatgaa
ccagaagcgacccaagtatgggattcatgtagatataccgctgaagaagaacgtgatttt
gttaaattccatttagggccaacacttgaaaaacacggttttgataacaaaaaaattgtt
atatgggatcataatcgagacttaatggtcgagcgtgcggaaaagatactatctgatcct
gaagcggcaaaatatatttggggtgtaggaaatcattggtatgtttcagaggaatttgag
aatctatcgaaagttcatgaaatgttcccaaataaacacctcatctttactgaaggttgt
atagaaggaggcgtacaattaggagcttggcatacaggagaacggtatgcaagaaatatc
ataggagatatgaataattggctagaagctttcctagattggaatatagtcttggatgaa
aagggcggcccaaaccatgttgggaattattgtgattccccagttatcgttgatacaaat
gaggatgtcgttcactataatagttcattttattatattggtcactttagtaaatatatt
aaaccgggtgcaaaacgaatagcaactaattcaaagatagagacgttatcgtacactgca
tttaaaaatagtgatggaagtattgcattagtagtcttaaatgaaacagagcaggatatc
ccttatacattgcaaatagaagggaaatatatcaacttaatatcaactaaaagatccatt
aatactatattaatttaa

DBGET integrated database retrieval system