KEGG   Bacillus cellulosilyticus: Bcell_1078Help
Entry
Bcell_1078        CDS       T01389                                 

Definition
pyridoxal phosphate-dependent protein, D-cysteine desulfhydrase family
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bco  Bacillus cellulosilyticus
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bco00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1205429..1206415
Genome map
AA seq 328 aa AA seqDB search
MKQFPRRIYTEAPTPIEKVTRFAAGLGGPNLYIKRDDLLGLTAGGNKTRKLEFLMGDALE
KGADTIITAGGIQSNHCRLTLAACVKEGLKCILVLEENELDLFHTKTSGNFLLFQLLGTE
NVKVVPNGTDVYAEMEKLARQVRGEGRTPYVIPVGGSNVTGITGYAACAEEIIEQAKEQG
IQFDYVVCTSGSGGMHAGLVAGLLAVDSAAKVIGINISRGKEEQEEKVYQLTKETAKHLG
LGREIPREAVVCFDDYVGPGYALPTEEMVEAVKRLASTEAILLDPVYTGKTMAGLIDLSG
KNYFQREDNILFLHSGGTPALYAYASLF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttccacgtcgaatttatacagaggcaccaacaccgatagaaaaggtcacc
cgatttgcagctggtttagggggaccgaatctctacattaaacgggatgatttgctcggt
ctcacagcgggaggtaataaaacgagaaagctagagtttctcatgggagacgcactggaa
aaaggggcagacacgattattaccgcagggggaatccaatcgaaccattgccgactcacc
ttagctgcctgtgtgaaagagggattgaagtgtattcttgttttggaggaaaatgagtta
gacctgttccatacgaagacgagcggtaattttctcttatttcagctattaggaacggag
aatgtaaaggttgtgccaaacggaacggatgtttatgcggaaatggagaagctagctcgg
caagtcaggggcgagggaagaactccctatgtcattccagtgggggggtccaatgtgaca
ggaataacggggtatgcagcctgtgcagaagaaattatcgagcaagcaaaagaacagggc
atacagtttgactatgtagtttgtacgagtggaagtggcggaatgcatgcagggttagtg
gctggacttttggccgtggatagtgcagctaaggtaatagggatcaatattagtcgcgga
aaagaggagcaagaagagaaggtgtatcagctcacgaaggaaacggctaagcatcttggc
ttgggaagagagatcccgcgggaagctgttgtttgctttgatgattatgttgggccaggc
tatgccttaccaacagaggaaatggtagaagcggtgaaacgactcgccagtacggaggcc
atcttacttgatcctgtttatacgggaaaaacaatggcagggcttatagatctcagtgga
aaaaactatttccaacgcgaggacaatattttattcctccattctggggggacacctgct
ttatacgcctatgcatctctattttaa

DBGET integrated database retrieval system