KEGG   Bacillus cellulosilyticus: Bcell_1078Help
Entry
Bcell_1078        CDS       T01389                                 

Definition
pyridoxal phosphate-dependent protein, D-cysteine desulfhydrase family
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bco  Bacillus cellulosilyticus
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bcell_1078
Enzymes [BR:bco01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Bcell_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1205429..1206415
Genome map
AA seq 328 aa AA seqDB search
MKQFPRRIYTEAPTPIEKVTRFAAGLGGPNLYIKRDDLLGLTAGGNKTRKLEFLMGDALE
KGADTIITAGGIQSNHCRLTLAACVKEGLKCILVLEENELDLFHTKTSGNFLLFQLLGTE
NVKVVPNGTDVYAEMEKLARQVRGEGRTPYVIPVGGSNVTGITGYAACAEEIIEQAKEQG
IQFDYVVCTSGSGGMHAGLVAGLLAVDSAAKVIGINISRGKEEQEEKVYQLTKETAKHLG
LGREIPREAVVCFDDYVGPGYALPTEEMVEAVKRLASTEAILLDPVYTGKTMAGLIDLSG
KNYFQREDNILFLHSGGTPALYAYASLF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttccacgtcgaatttatacagaggcaccaacaccgatagaaaaggtcacc
cgatttgcagctggtttagggggaccgaatctctacattaaacgggatgatttgctcggt
ctcacagcgggaggtaataaaacgagaaagctagagtttctcatgggagacgcactggaa
aaaggggcagacacgattattaccgcagggggaatccaatcgaaccattgccgactcacc
ttagctgcctgtgtgaaagagggattgaagtgtattcttgttttggaggaaaatgagtta
gacctgttccatacgaagacgagcggtaattttctcttatttcagctattaggaacggag
aatgtaaaggttgtgccaaacggaacggatgtttatgcggaaatggagaagctagctcgg
caagtcaggggcgagggaagaactccctatgtcattccagtgggggggtccaatgtgaca
ggaataacggggtatgcagcctgtgcagaagaaattatcgagcaagcaaaagaacagggc
atacagtttgactatgtagtttgtacgagtggaagtggcggaatgcatgcagggttagtg
gctggacttttggccgtggatagtgcagctaaggtaatagggatcaatattagtcgcgga
aaagaggagcaagaagagaaggtgtatcagctcacgaaggaaacggctaagcatcttggc
ttgggaagagagatcccgcgggaagctgttgtttgctttgatgattatgttgggccaggc
tatgccttaccaacagaggaaatggtagaagcggtgaaacgactcgccagtacggaggcc
atcttacttgatcctgtttatacgggaaaaacaatggcagggcttatagatctcagtgga
aaaaactatttccaacgcgaggacaatattttattcctccattctggggggacacctgct
ttatacgcctatgcatctctattttaa

DBGET integrated database retrieval system