KEGG   Bacillus cellulosilyticus: Bcell_1099Help
Entry
Bcell_1099        CDS       T01389                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bco  Bacillus cellulosilyticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bcell_1099
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bcell_1099
   00600 Sphingolipid metabolism
    Bcell_1099
Enzymes [BR:bco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Bcell_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1231515..1233731
Genome map
AA seq 738 aa AA seqDB search
MAIVFHEDAKEFHLYNNEISYIIKILENNQLGNLYYGKKVRDRNSFAHLLKGDLRPLNAY
VFENDYTLSLQQTKQEYPSYGTTDFRYPAFEIKQENGSRITNFEYHSHQIFHGKKKLDGL
PATYVEEENEATTLEITLFDRIINTKIILSYCIYENLPIITRNTRFIHEGNSKIILTRSM
SASVDLPDSHFDMIHLAGAWSRERHVKVRKLEQGTQGIHSMTGTSSAEHNPFIALKRPNT
DETSGEAYGFSFVYSGNHLEQVEVDTFGRTRVLIGIHPDTFEWPLEEGEEFQTPEVVMTY
SDKGLNKMSQSFHTLYRTRLARGYWRDKPRPVVINNWEATDMDFTEEKILSIARAGKELG
AELFVLDDGWFGSRDNDKAGLGDWYVTNFNKLPEGITGLAKKVEEMGLKFGLWFEPEMVN
KDSDLYRKHPDWIISTPNRRQSPSRNQHVLDYSREEVVDYIYRLMERVLSEAKISYVKWD
MNRYITECFSHVKTAENQGKTFHQYVLGVYSLYERLMERFPYILFESCSSGGARFDPGIL
YYAPQGWTSDDTDAVERLKIQYGTSFVYPVSSMGAHVSEVPNHQVRRTTPIETRANVAYF
GAFGYEMDLNTLSDREKEVVKKQITFYKSHRELLLYGTFYRHLSPFEQQITAWSVVAQDK
SEAIAGYYKALNAPNDSWKRLKLLGLDPNKQYILNGSPNSIHYGDELMQVGMMIDDSDFC
ANAGDFSSALFVLREMKE
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtatttcatgaagacgcaaaagagtttcatctttataacaatgaaattagt
tatattataaaaatcttagaaaacaatcaacttggaaatttgtattatggaaagaaggtt
cgagaccgaaatagttttgcacacttgctaaaaggagacttaagacctttaaatgcgtat
gtatttgaaaatgactatacattatcattacaacaaacgaagcaagagtatccatcctat
ggtactacggatttcagatatcctgcctttgaaatcaaacaagaaaatggtagcagaatt
actaattttgagtatcattcacatcaaatatttcatgggaagaaaaaactagatggtctg
ccagcaacttatgtagaggaggagaacgaggcaacaacgcttgaaatcactttgtttgat
cgtatcattaatacgaaaataattcttagctactgtatctatgaaaaccttccaatcatc
actaggaatactaggtttattcatgaaggaaacagcaaaatcattcttactagatcaatg
agtgcgtcagtcgatttaccagatagtcattttgatatgattcatttagctggagcttgg
agtagagagcggcatgtaaaggtgaggaaattagagcaaggtacgcaaggaattcacagt
atgacaggtacgagtagcgcagaacataatccttttatcgctttgaaaagacctaatacg
gacgaaacctctggcgaagcttacggatttagttttgtttatagtggaaaccatttagaa
caagtggaggtcgatacttttggtcgaacgagggttcttataggtatccatccagatacc
tttgaatggcctttggaggaaggggaagaattccaaacacctgaagttgtcatgacgtat
tccgataaagggttaaataaaatgagtcagtcttttcatactctataccgtactaggtta
gcacgaggatattggagagataagccaagaccagtagtcattaacaactgggaagcgaca
gatatggattttacggaagagaaaatattgagcattgctagagcaggaaaagagctaggg
gcagagttatttgtattggacgatggttggtttggtagtcgagacaatgataaagcaggt
ttaggagattggtacgttacaaactttaacaaactaccagaaggtattactggcctagct
aaaaaagtagaagaaatgggattaaagtttggtctttggtttgaaccggaaatggtgaac
aaggatagtgatttatatcgtaagcaccctgattggattatttcgacaccgaaccgccga
caatcaccttcacgaaatcagcatgtactagattactcaagagaagaagtagttgattat
atatatcgtttaatggaacgagtgttaagtgaggcgaaaatatcttatgtgaaatgggat
atgaatcggtatattacagaatgtttttcacatgtgaaaacagcggagaatcaaggtaaa
acttttcatcaatatgtacttggtgtttattctttatatgaaagattaatggaaagattt
ccatacattttgtttgaatcatgctctagtggtggtgcaagatttgatccaggtatactc
tactatgcacctcaaggatggactagtgatgataccgatgcagttgagcgattgaaaata
caatatggtacttcttttgtttatcctgtcagtagtatgggcgcacacgtatcggaggtt
ccgaatcaccaagtaaggcgaacgacacctattgaaacgagagcaaacgttgcttatttt
ggtgcttttggatatgaaatggacttgaacacgttgtcggatagagaaaaagaagtagta
aaaaagcaaataaccttttataaatctcatagagaactgttactgtatggaacgttctat
cgacatttaagtccttttgagcagcaaataactgcatggagtgttgttgcacaagataaa
tcagaggcaattgccggatactataaggcattgaatgcacctaacgatagttggaaacga
ttaaaactcctcggtttagatccgaacaaacaatatatattgaatggcagtcctaacagt
atccattatggggatgagctaatgcaagttgggatgatgatcgatgacagtgatttttgt
gcgaatgctggtgatttctcttctgctttgtttgtcctaagagagatgaaggaatga

DBGET integrated database retrieval system