KEGG   Bacillus cellulosilyticus: Bcell_1103Help
Entry
Bcell_1103        CDS       T01389                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bco  Bacillus cellulosilyticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bco00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bco00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bco00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1241147..1243216
Genome map
AA seq 689 aa AA seqDB search
MEISDEKDIRLLHFGAHPFLEEDGWDDRKRSKFRLIELHVSGENQLDHHGSKHTGTSPGN
RLKYCNRYDSRNDRGRKIEIYLTDKITNLDVTCHMQFYDNIPFIKSWSVVSNSGSEPVGL
EYISSFALTGIDKEGLRTREDKVNLHIPHHTWFGEAQWKEYTLPELGFHSVNEFSMKRIS
YSSTGTWSTSEYAPTAVFENKEAGTCLAWQIEHHGSWHWEISDRNELLYLQVSGPTEVEN
QWWKSLHPGEKFETVPVAIGSVEGDFEEVINAMNQYRRSIRRENRDNESLPVIFNDYMNC
LFGDPTTKKLMPLIDAAARAGCEIYCIDCGWYSDGEWWDGVGEWLPSKARFPHGIEEVMA
HIRRKGMIPGLWLELEVMGINCNIASKVPDDWFFLLHGKRVIDHSRYQLDYRNSEVVAYA
NRVIDRLVSEYGVGYIKMDYNINAGVGTELNADSFGDGLLEHNRAYLRWLDQIFMKYPDL
IIENCSSGGMRMDYALLSRHSIQSTSDQTDYVKNGVIAAASSSLVTPEQCAVWSYPLKDG
DDEEVIFNMVNAILLRIHQSGHLSEITEDRFKLVAEAIKYYKSIREYIPKSKSIWPLGIP
SFYSEWNAFGLVHHNHYFMAVWRMNSDSNVISIPLKDLKGEDVKVEVAYPKNNNTKWRWN
KLKGELTVRMTETYSARLFEIRKCEALVE
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
ttggagattagtgatgagaaagatataagactattacatttcggagcgcatccttttcta
gaagaggatggatgggacgatcgtaaaaggagtaagtttagattaatcgaacttcacgtc
tcaggtgaaaatcaactagatcatcatgggtcaaaacatactggaacgagtccagggaac
cgattaaagtattgcaatcggtatgatagtaggaatgatagagggcggaaaatagagata
taccttactgataagataactaatttggatgtgacttgtcatatgcaattttatgacaat
attccatttatcaaaagttggtcagtagtctcaaattctggctcagagcctgtaggtttg
gagtatatatcctcgtttgcattgacgggtattgataaagaaggattacgtacgagagaa
gataaagttaaccttcacataccacatcatacgtggtttggtgaagcgcagtggaaggaa
tatacattaccggaattagggtttcattccgtcaacgagttttccatgaaaagaatctcc
tacagtagtacaggtacatggtcaacttctgagtatgcccctacggcagtgtttgaaaat
aaggaagctggaacttgtttagcttggcaaattgaacatcacggatcatggcactgggaa
ataagtgataggaacgagttgttgtatttacaagtaagtggaccaaccgaagtggaaaac
caatggtggaagtctcttcatcctggggaaaaatttgaaacagttccagttgcaattggt
tctgttgaaggggattttgaagaagtgatcaacgcgatgaatcagtatcggaggagtata
cgtcgcgagaatagagacaatgaatctcttcctgttattttcaatgattatatgaattgt
ttatttggtgatccgacgacgaagaagcttatgccattaattgatgcagcagctcgtgct
ggctgtgaaatctattgtattgattgtggatggtactctgatggagaatggtgggatggt
gtaggggaatggctaccttcaaaagcacgtttccctcatggtatagaggaagtcatggcg
catataaggcgaaaagggatgattccaggtttgtggctggaattagaggttatggggata
aactgtaatatagcttcaaaagtaccagatgactggttttttctcctccatggaaaaagg
gtgatagatcactcaagatatcagttagattatagaaactctgaagttgtggcgtatgca
aatagagtgatagatcgtttagtctccgaatacggcgttggctatattaaaatggattat
aatataaacgcaggtgtcggaacagaattaaatgcggatagttttggtgacggattgtta
gagcataatcgggcatatttacgttggctagatcaaatctttatgaaatacccagattta
attattgaaaactgtagcagtggtggaatgagaatggattatgctctattaagcagacat
agcatacagtcaacaagtgatcaaacagattacgtgaaaaatggagtaatagctgcagct
tcatcttcattagttactcccgaacagtgcgctgtttggtcgtatccattaaaagatggt
gatgatgaagaagtgatttttaatatggtgaatgcgattttgctacgcatccaccaaagt
ggccatttaagtgagataacagaagacaggtttaagctcgttgcagaagctattaaatat
tataaatcgattcgtgaatacattcctaaatctaaatctatctggcctttaggcatccca
tccttttattctgaatggaatgcatttggactcgttcatcacaatcattatttcatggca
gtctggagaatgaatagtgacagtaatgttatttcaatcccactaaaggacttgaaggga
gaagacgtcaaggtagaagtggcataccctaaaaataataatacaaagtggcgttggaat
aaattgaaaggtgaactaaccgttaggatgacagaaacatatagtgcaagattatttgag
ataaggaaatgtgaagcattagttgagtga

DBGET integrated database retrieval system