KEGG   Bacillus cellulosilyticus: Bcell_1192Help
Entry
Bcell_1192        CDS       T01389                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bcell_1192
Enzymes [BR:bco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bcell_1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Cellulase Glyco_hydro_14 Glyco_hydro_2_C DUF2194 DUF4434 DUF4838
Motif
Other DBs
NCBI-ProteinID: ADU29457
UniProt: E6TRT4
Position
1354527..1356551
Genome map
AA seq 674 aa AA seqDB search
MINSKLPKIWYGGDYNPEQWDDPEIWNEDIRMFKKAGIDIATLNVFSWALNQPDEDTYDF
TALDEHINRLYENGIYTCLATSTAAHPAWMARKYPDVLRVDFHGRKRAFGGRHNSCPNSP
TYRKYAERMADKLGERYQDHPAVLIWHVSNEYGGYCYCDNCAKAFREWLKKKYGNLQTLN
KTWNTRFWGHTFHDWEDIVVPNALSEEGEGNVSAFQGISLDYRRFQSDSLLECYKLEHNM
LKKHTPNVPITTNLMGTYPELDYFKWGKEMDVVSWDSYPGIDTPVSLTAMTHDLMRGLKG
GQPFMLMEQTPSQQNWQPYNALKRPGVMRLWSYQALAHGADTIMFFQLRRSIGACEKFHG
AVIEHVGHENTRVFRETSQLGKEIQKLSDSFIDSRTNARVAIVYDWENRWAIDLSSGPSV
SLDYVNEVHKYYAALYERNIPVDMVSVEEDISKYDIVIAPVLYMVKSGYAKKLEAFVENG
GTFVTTFFSGIVNEHDLVTLGGYPGELRKLLGLWVEEIDALDPKHHNQIVMKDSWGSLEG
SYHCNVLFDIIHVEGAEIVAEYGSEFYKGTPVVTANTYGNGRAIYVGSSGEQQFITGLMR
NLCDEKGIEPLMETPNGVEVSERRKDSKSYLFVMNHNETKEELAIETEMLDLLTGKTVRG
TVHIEGHGVMILEK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgattaatagtaagctaccaaaaatttggtacggtggagattacaatccggagcagtgg
gatgatccagaaatctggaatgaagacattaggatgtttaaaaaagcaggtattgatata
gctactttaaacgtgttttcttgggctttgaatcaacctgatgaagatacatatgatttt
acagctttggatgagcatattaatcggctttatgaaaatggcatttatacgtgtttagct
acgagtacggcagcacacccggcttggatggcaagaaagtacccagatgttttaagagta
gattttcatggtagaaaaagagcgtttggtggaaggcataattcatgtccgaatagtccg
acttaccggaaatacgcagaaagaatggctgacaaattaggggaacgatatcaagatcat
ccagcagttttaatttggcatgtatctaatgaatacggaggctattgctactgtgacaat
tgtgcaaaagcctttcgtgaatggctaaaaaagaaatacggtaacctacaaacccttaat
aaaacgtggaacacaagattctggggacatacgtttcatgattgggaagacattgtcgtg
cctaacgcattaagtgaagaaggggaaggaaacgtcagtgccttccaagggatatcatta
gattaccgtagattccaatctgatagtttactagaatgctataaattagaacacaacatg
ttaaaaaaacatacaccgaatgtaccgattacgacgaatttaatgggaacatatcctgaa
cttgattatttcaagtggggaaaagagatggatgttgtttcgtgggatagctaccctggc
atagatacgccagttagtttaacggcaatgacacacgatcttatgcgaggattaaaaggt
gggcagccattcatgctcatggagcaaactccaagccagcaaaattggcagccttataat
gctcttaagcgcccaggggtaatgaggctatggagttatcaagctcttgcgcatggtgcc
gataccattatgttttttcaattgcgccgatcgataggtgcatgcgaaaagttccacggt
gccgttattgaacatgttggtcatgagaatacgagagtatttagggaaacatctcagctc
ggcaaagagatacaaaagctatcagattcgtttatcgatagtagaacaaatgcaagagta
gcaatcgtatatgattgggagaatcgttgggctattgatttatctagcgggccatcggtg
tcattagattacgtcaatgaagttcataaatactatgctgctttgtacgaaaggaatatt
cctgtagacatggtcagtgtggaggaggatatttcaaaatatgacatagtaatcgcacca
gttttgtatatggtgaaaagtggttatgcgaaaaagctagaagcgtttgttgaaaatggc
ggcacgttcgtgactactttctttagtggaatcgtcaatgagcacgatctagtgacactt
ggtggttatccaggtgaacttagaaaactattagggctatgggtagaagagattgatgcg
ctagaccctaagcatcataatcaaatagtgatgaaggattcgtggggctccttggaggga
agctaccattgcaacgtgctttttgacataatacatgtagaaggggcagagattgtagca
gagtatggatcagagttttataagggaacaccagtagtaacggccaatacttacggaaat
ggaagggcaatttatgttggctcaagtggtgaacaacaattcattaccggcttaatgcgt
aatttatgtgatgaaaaaggaatagagcctctaatggaaacgccaaatggtgtcgaggta
tcagaaagaaggaaagatagcaaatcgtatttatttgtgatgaatcataacgaaacaaaa
gaagaattagccatagaaacggaaatgctcgatttgttaactggaaaaacggtaagggga
acagttcatatagaaggtcatggtgtcatgatattagagaagtaa

DBGET integrated database retrieval system