KEGG   Bacillus cellulosilyticus: Bcell_1481Help
Entry
Bcell_1481        CDS       T01389                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bco  Bacillus cellulosilyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcell_1481
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bcell_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1674916..1676337
Genome map
AA seq 473 aa AA seqDB search
MPKRIAIIGGGITGLSAAYYLQKELSKSNSDAEFVLYEAADELGGKIKTSYRDGFISELG
PDSFLARKKSMAELAKEVGLENDLVHNSSGKSYILHNDTLYPMPGGAIMGIPTQWGPFLK
TRLFSPAGKARAAGDLFLPKVMKNGEDVSLGSFFRKRLGNEVVDKLIEPLLSGIYAGNID
KLSLQATFPHFEQIEKKYGSMILGMKSSIAKQQEGKPKNRGKTKPKGMFLSFKGGLQSFV
RAIEEQLDKSVVKKNAKLLQIKKVDNRYRLLFEDGRDDVVDYMLITTPHHITYQLLKDYS
AVSYLGKMPATSVATVVLAFPKSAIKKDIDGSGFVVSKKSNYSITACTWTHKKWEHSTPE
GYAQLRGYVGREGNEDIVFRSDEEIIHAVMKDLSAIMDIEGEPKFSTVTRWKEAMPQYEV
GHRNNLNDVYVSMKKQLPGVYLTGGSFEGIGMPDCIDQGKKGVSNLLSELGAN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaacgtattgcaattattggtggtggtattacaggtttaagtgccgcctattat
ttacaaaaggagttatccaagtcaaacagtgatgcagaattcgtgttgtatgaagcggct
gacgagctaggtggtaaaattaaaacatcttatcgcgatggatttatatcagaactagga
cctgattcatttttggctaggaaaaaaagtatggctgaattagcgaaagaagttggatta
gaaaatgacctcgtacataacagctcaggtaagtcctatattcttcacaatgatacactt
tatcccatgccaggcggggcaattatggggataccaacacagtgggggccattcttaaaa
actcgtttattctctccagctggaaaagctagagcagctggggatctgtttttaccgaaa
gtaatgaaaaacggtgaagatgtgtcattagggagctttttcagaaaacggcttggtaat
gaagttgttgataagctaattgaaccgttactatctggtatttatgcaggaaacattgac
aaacttagcttacaagcaacatttccacactttgaacaaatagaaaagaagtatggtagc
atgattttaggtatgaagtcttcaatagctaaacagcaggaagggaagccaaaaaatagg
ggaaaaacaaagccgaagggaatgtttctatcttttaaaggtggacttcaatcttttgtt
agagcgatcgaagagcaattagacaaatctgtagtgaagaagaatgcaaagcttctgcaa
ataaaaaaagttgataatcgatatcggttgctattcgaggatggaagagatgatgtagtg
gattatatgcttataacaacccctcatcatattacttatcagttattaaaggattattca
gcagtaagttatttaggcaaaatgcctgcaacttcagtagccaccgtcgttcttgctttc
ccaaaatcagcaataaagaaagatattgacggctctggtttcgttgtttctaaaaagtca
aactactccattactgcttgtacatggacacacaaaaaatgggagcattctactcctgaa
ggttatgcacaattacgtggctatgtagggagggaaggaaacgaagacatcgtattccga
tcagatgaagaaattatacatgcagttatgaaggatttgagtgcaataatggatatagaa
ggagaaccgaagttttctactgtaacacgctggaaagaggcgatgcctcaatacgaagta
ggtcataggaataatttaaatgatgtttatgtcagtatgaagaagcaattacctggagtt
tacttgacgggtggatcctttgaagggattggtatgcctgattgtatcgatcaaggaaaa
aaaggtgtaagtaatttgttgtctgagcttggagctaactga

DBGET integrated database retrieval system