KEGG   Bacillus cellulosilyticus: Bcell_1490Help
Entry
Bcell_1490        CDS       T01389                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bco  Bacillus cellulosilyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcell_1490
Enzymes [BR:bco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bcell_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1685926..1686540
Genome map
AA seq 204 aa AA seqDB search
MIESLTGVVSNIEIESVTLNVHDVGYLVFCANPFRYEENINEKVTIYTYQHVREDAIKLY
GFKNRDERKLFEKLLQVSGIGPKGALAILATGEPTLVVQAIEAENEKFLVKFPGVGKKTA
RQIILDLKGKLVDFLQESGGEDTKLIAIDDDMQLENYELEEALEALKALGYVDREINKVL
PKLKDTKETTDGYIKIALKLMLES
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatcattaacaggagtagtatcgaatattgaaatagaaagtgtaacacttaat
gtgcacgatgtaggatatttagtattttgtgcaaacccgtttcgttatgaagaaaatata
aatgaaaaagtaacaatttatacatatcaacatgtaagagaagatgctattaagctttat
ggctttaaaaatcgtgatgagaggaagctttttgaaaaattactgcaagtttctggtata
ggtccaaaaggtgcattagcaatattagctacaggagaaccaacgctagttgttcaagca
attgaggcagagaatgaaaagttcttagttaaatttccaggtgttggaaagaagacggcg
cgtcaaattatccttgatttaaaagggaagttagttgatttcttacaagaaagtggtgga
gaagatacaaaacttatagctatcgatgacgatatgcaacttgaaaattatgagttagag
gaagcgcttgaagctttaaaggcactaggatacgttgatcgggaaattaataaagtattg
ccaaaattaaaagatacaaaagaaacaacggatggttatattaaaatagctcttaaatta
atgctcgaatcatga

DBGET integrated database retrieval system