KEGG   Bacillus cellulosilyticus: Bcell_1520Help
Entry
Bcell_1520        CDS       T01389                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcell_1520
Enzymes [BR:bco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bcell_1520
DNA repair and recombination proteins [BR:bco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Bcell_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 Zeta_toxin UvrD_C UvrD-helicase AAA_18 T2SSE AAA_5 AAA_22 AAA_28 AAA HTH_IclR HHH AAA_14 AAA_33 TsaE DEAD NTPase_1 IMS_HHH AAA_17 RsgA_GTPase DUF4926 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADU29783
UniProt: E6TV99
Position
1717899..1720190
Genome map
AA seq 763 aa AA seqDB search
MVEDNQKDYIKGDLLHLIYHNEESLYTVAKIKVTETSYSMDDKEVAIVGIMPPIERDVSY
LFYGFFSDHPRFGRQYKVEQFHKIMPETEQGIILYLSSDRFPGIGKKTAEKIVQTLGKNA
ISIIIENRSSLDKVTSIKRDKADEIYETLLEDQGIEQVLVRLYEYGFGLQLAMKVYQAYK
TDALDIINHNPYKMIEDVEGIGFAKADLIGRKQGIEGAHPDRLRAAIIFTLNEQSLNEGH
VYVLNETIVKGAKALLEYENTEEISPLKIADQVIELGEEGKVIVDGDKMYIPTLYYAEQG
IVSNIQRLLEREPEKYPDSEFYKALGLVEETLGIHYAPSQQEAIKEALHSPVMILTGGPG
TGKTTVIKGLVEVYGQLNGMSVNPDDYAKKDAFPIIMAAPTGRAAKRMSESTGLPSSTIH
RLLGFKGTEDYEDDEVEKLEGELIILDEMSMVDTWLANQLFKAIPNDMKVILVGDEDQLP
SVGPGQVLSDLLTTNIVPSVKLTDIYRQSEGSHIITFSHSVKDGHLDQVKKDSKDLRFFP
AAQQQIPDVVKQICKGAIAKGYEPKDIQVLAPMYRGIAGVENLNVMLQSLFNPPTPQRRE
VPFGDVVYRTGDIVLQLVNNPEENVFNGDRGEIVAIFTEKENTDKELKIVISFDGIEITY
TKQELTQITHAYCCSIHKSQGSEFPIVIMPIVKGYYRMLRKKLIYTGITRAKNFLLLCGE
WQSLEYAVKNDQDIKRNTTLALKLKNEPMENEYQHETDGASKH
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtagaggacaatcaaaaggattatattaaaggtgatttgctccatttaatttatcat
aatgaggaatcgctttatacggtagcaaaaatcaaagtaacagaaacgtcatattccatg
gacgataaagaggtggcgatagttggtattatgccaccaattgaaagagatgttagctac
cttttttatggtttcttttcagatcacccgcgatttggccgtcaatataaagtggagcaa
tttcataagattatgcctgaaacggagcaagggattattttatacctttctagtgatcgt
tttcctggtatcggtaagaagactgctgaaaagatcgttcaaacattagggaagaatgcc
atttcgatcattattgaaaatcgttcttcactggacaaagtaacgagtattaaacgtgat
aaagctgatgaaatttatgagacactactagaagatcaggggattgaacaagtattagta
aggctatatgaatatgggtttggcttacagctagctatgaaagtataccaagcttataaa
actgatgctttggatatcattaatcacaacccttataagatgattgaagatgtagaggga
attggctttgctaaagctgacttaattggcagaaaacaagggattgaaggagcacatcct
gaccgattaagggcagcgattatttttaccttaaatgagcaatctctcaacgagggacac
gtgtatgttttaaatgagacgattgttaaaggagcaaaggctttactagagtatgaaaac
accgaagagatatctccattaaaaatagctgatcaagttattgaattaggcgaagaaggt
aaggttatcgttgatggagataaaatgtatatacctacgttatattatgctgaacaagga
attgtgtctaacatacaacggttattggagagagaaccagaaaagtatccagattcggag
ttttataaagcgcttggattagtagaggaaacgcttggcattcattatgcaccatcacag
caggaggcaataaaagaagcgcttcattccccggttatgattttgacaggagggccggga
actggaaaaacaacagtaataaaagggctcgttgaagtttatggacaattaaacggtatg
tctgtaaaccctgatgattatgctaaaaaagatgcttttcctataataatggcggcacct
acaggaagagcagctaaacgaatgagtgaatcaactggcttaccttcttcaacgatccat
cgcttactcggttttaaaggtaccgaagattatgaagacgatgaggtagaaaaactagag
ggagagctcattattttagatgaaatgtcgatggtcgatacgtggctagctaaccaattg
ttcaaagcaattccgaatgacatgaaagtaatactagtcggtgatgaggatcaattacca
tctgttggtccaggacaagtattatcggatttattaactactaacatcgttccttcagta
aaattaacagacatttatcgtcaatcagaaggctctcatattatcaccttttcccattca
gtgaaagatggtcacttagatcaagtcaaaaaagatagtaaagatttacgctttttcccg
gctgcacagcaacaaattccagatgtagtaaagcaaatatgtaaaggcgcaatagcgaaa
gggtatgaacctaaagatatccaagtgttagctccgatgtaccgtggaattgcaggagta
gaaaatttaaacgtcatgctacaatcactatttaatcccccaacaccacaaagaagggaa
gttccttttggggatgttgtttatcgaactggtgatattgtactccaattagtgaacaat
cctgaagaaaatgtatttaatggagaccgtggcgaaattgttgcaatatttactgaaaaa
gaaaatacagataaagagttaaaaattgtcatttcttttgatgggatagaaattacctat
acaaaacaagaattaacacaaattacacatgcctattgctgctctattcataagtcacaa
ggcagtgaattcccaatcgtcattatgccgattgtaaagggatactatcgtatgctccga
aaaaaattaatttatacgggaattacgagggctaaaaactttcttttactatgtggtgaa
tggcaatcacttgaatatgctgtaaaaaatgaccaagatataaaacggaacacgacgttg
gctttaaaattaaaaaatgaaccgatggaaaatgaataccagcatgaaactgatggtgca
tccaaacactag

DBGET integrated database retrieval system