KEGG   Bacillus cellulosilyticus: Bcell_1520Help
Entry
Bcell_1520        CDS       T01389                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bco  Bacillus cellulosilyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcell_1520
Enzymes [BR:bco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bcell_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1717899..1720190
Genome map
AA seq 763 aa AA seqDB search
MVEDNQKDYIKGDLLHLIYHNEESLYTVAKIKVTETSYSMDDKEVAIVGIMPPIERDVSY
LFYGFFSDHPRFGRQYKVEQFHKIMPETEQGIILYLSSDRFPGIGKKTAEKIVQTLGKNA
ISIIIENRSSLDKVTSIKRDKADEIYETLLEDQGIEQVLVRLYEYGFGLQLAMKVYQAYK
TDALDIINHNPYKMIEDVEGIGFAKADLIGRKQGIEGAHPDRLRAAIIFTLNEQSLNEGH
VYVLNETIVKGAKALLEYENTEEISPLKIADQVIELGEEGKVIVDGDKMYIPTLYYAEQG
IVSNIQRLLEREPEKYPDSEFYKALGLVEETLGIHYAPSQQEAIKEALHSPVMILTGGPG
TGKTTVIKGLVEVYGQLNGMSVNPDDYAKKDAFPIIMAAPTGRAAKRMSESTGLPSSTIH
RLLGFKGTEDYEDDEVEKLEGELIILDEMSMVDTWLANQLFKAIPNDMKVILVGDEDQLP
SVGPGQVLSDLLTTNIVPSVKLTDIYRQSEGSHIITFSHSVKDGHLDQVKKDSKDLRFFP
AAQQQIPDVVKQICKGAIAKGYEPKDIQVLAPMYRGIAGVENLNVMLQSLFNPPTPQRRE
VPFGDVVYRTGDIVLQLVNNPEENVFNGDRGEIVAIFTEKENTDKELKIVISFDGIEITY
TKQELTQITHAYCCSIHKSQGSEFPIVIMPIVKGYYRMLRKKLIYTGITRAKNFLLLCGE
WQSLEYAVKNDQDIKRNTTLALKLKNEPMENEYQHETDGASKH
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtagaggacaatcaaaaggattatattaaaggtgatttgctccatttaatttatcat
aatgaggaatcgctttatacggtagcaaaaatcaaagtaacagaaacgtcatattccatg
gacgataaagaggtggcgatagttggtattatgccaccaattgaaagagatgttagctac
cttttttatggtttcttttcagatcacccgcgatttggccgtcaatataaagtggagcaa
tttcataagattatgcctgaaacggagcaagggattattttatacctttctagtgatcgt
tttcctggtatcggtaagaagactgctgaaaagatcgttcaaacattagggaagaatgcc
atttcgatcattattgaaaatcgttcttcactggacaaagtaacgagtattaaacgtgat
aaagctgatgaaatttatgagacactactagaagatcaggggattgaacaagtattagta
aggctatatgaatatgggtttggcttacagctagctatgaaagtataccaagcttataaa
actgatgctttggatatcattaatcacaacccttataagatgattgaagatgtagaggga
attggctttgctaaagctgacttaattggcagaaaacaagggattgaaggagcacatcct
gaccgattaagggcagcgattatttttaccttaaatgagcaatctctcaacgagggacac
gtgtatgttttaaatgagacgattgttaaaggagcaaaggctttactagagtatgaaaac
accgaagagatatctccattaaaaatagctgatcaagttattgaattaggcgaagaaggt
aaggttatcgttgatggagataaaatgtatatacctacgttatattatgctgaacaagga
attgtgtctaacatacaacggttattggagagagaaccagaaaagtatccagattcggag
ttttataaagcgcttggattagtagaggaaacgcttggcattcattatgcaccatcacag
caggaggcaataaaagaagcgcttcattccccggttatgattttgacaggagggccggga
actggaaaaacaacagtaataaaagggctcgttgaagtttatggacaattaaacggtatg
tctgtaaaccctgatgattatgctaaaaaagatgcttttcctataataatggcggcacct
acaggaagagcagctaaacgaatgagtgaatcaactggcttaccttcttcaacgatccat
cgcttactcggttttaaaggtaccgaagattatgaagacgatgaggtagaaaaactagag
ggagagctcattattttagatgaaatgtcgatggtcgatacgtggctagctaaccaattg
ttcaaagcaattccgaatgacatgaaagtaatactagtcggtgatgaggatcaattacca
tctgttggtccaggacaagtattatcggatttattaactactaacatcgttccttcagta
aaattaacagacatttatcgtcaatcagaaggctctcatattatcaccttttcccattca
gtgaaagatggtcacttagatcaagtcaaaaaagatagtaaagatttacgctttttcccg
gctgcacagcaacaaattccagatgtagtaaagcaaatatgtaaaggcgcaatagcgaaa
gggtatgaacctaaagatatccaagtgttagctccgatgtaccgtggaattgcaggagta
gaaaatttaaacgtcatgctacaatcactatttaatcccccaacaccacaaagaagggaa
gttccttttggggatgttgtttatcgaactggtgatattgtactccaattagtgaacaat
cctgaagaaaatgtatttaatggagaccgtggcgaaattgttgcaatatttactgaaaaa
gaaaatacagataaagagttaaaaattgtcatttcttttgatgggatagaaattacctat
acaaaacaagaattaacacaaattacacatgcctattgctgctctattcataagtcacaa
ggcagtgaattcccaatcgtcattatgccgattgtaaagggatactatcgtatgctccga
aaaaaattaatttatacgggaattacgagggctaaaaactttcttttactatgtggtgaa
tggcaatcacttgaatatgctgtaaaaaatgaccaagatataaaacggaacacgacgttg
gctttaaaattaaaaaatgaaccgatggaaaatgaataccagcatgaaactgatggtgca
tccaaacactag

DBGET integrated database retrieval system