KEGG   Bacillus cellulosilyticus: Bcell_1665Help
Entry
Bcell_1665        CDS       T01389                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00010  Glycolysis / Gluconeogenesis
bco00052  Galactose metabolism
bco00500  Starch and sucrose metabolism
bco00520  Amino sugar and nucleotide sugar metabolism
bco00521  Streptomycin biosynthesis
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
bco01130  Biosynthesis of antibiotics
bco01200  Carbon metabolism
Module
bco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_1665
   00052 Galactose metabolism
    Bcell_1665
   00500 Starch and sucrose metabolism
    Bcell_1665
   00520 Amino sugar and nucleotide sugar metabolism
    Bcell_1665
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcell_1665
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bcell_1665
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bcell_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADU29928
UniProt: E6TWX8
Position
1858192..1859151
Genome map
AA seq 319 aa AA seqDB search
MEKNMLVGVDIGGTTVKIALIDIEGTMKMKWEINTNTAEHGKYIVSDIVHSVEEKLKENA
ISKDNVIGIGLGAPGFIDVEKGLIFEAVNLGWKDFALKEKMEEAIHIPTFVDNDANLAAV
GEMWQGAGEGAENLLCVTLGTGVGGGVIAGGEIIHGQSGMAGEIGHIATVLENGAPCNCG
KKGCLETVASATGIARLGTEAATVSTAGVLKDTLEANGALTAKDVFDAAKAGDTVAQNVV
KEASHHLGLVLANLANALNPEKIVLGGGVSKAGDILVGEIKKYFTSYAIPKIGRETHIKI
ATLGNDAGVYGAAWLAKQG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaacatgctagtaggagtagatataggtggaactacagtaaaaatcgccttg
attgatattgaaggtacgatgaaaatgaaatgggaaattaatacaaatacagcggaacat
ggaaaatatattgtttcagatatcgttcatagtgtggaagaaaaattaaaagagaatgcg
atcagtaaagataacgtgataggaattggtttgggggcaccaggctttattgatgttgag
aagggattaatctttgaagcggttaatttaggatggaaagattttgcgttaaaggaaaaa
atggaagaagctattcatataccgacttttgttgataatgatgccaacttagcagccgta
ggtgaaatgtggcaaggggctggagaaggagcagaaaatctactctgtgttacattagga
actggtgttggcggaggcgtcattgctggtggagaaatcattcatggtcaaagtggtatg
gcgggtgaaatcggtcatattgcaacagtacttgaaaatggtgcgccttgtaattgtggg
aaaaagggttgtctagaaactgtcgcttctgctacaggtattgcacgcttaggaacggaa
gctgctacagtaagtacagcaggggtgttaaaagatacactggaagcaaatggtgcttta
acagctaaagatgtttttgatgcagctaaagctggtgataccgtagcacaaaatgttgtg
aaagaagcttctcaccatttaggtcttgttttagcaaatttagcaaatgcgctaaatcct
gaaaagattgtgttaggtggcggtgtttcaaaagcgggagatattttagttggtgagatt
aagaagtactttacatcttatgcgattccaaaaattggacgtgagacacatataaaaatt
gcaacattagggaatgatgctggtgtgtatggagcagcatggttagcaaagcaaggttaa

DBGET integrated database retrieval system