KEGG   Bacillus cellulosilyticus: Bcell_1665Help
Entry
Bcell_1665        CDS       T01389                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcell_1665
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_1665
   00052 Galactose metabolism
    Bcell_1665
   00500 Starch and sucrose metabolism
    Bcell_1665
   00520 Amino sugar and nucleotide sugar metabolism
    Bcell_1665
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcell_1665
   00524 Butirosin and neomycin biosynthesis
    Bcell_1665
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bcell_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1858192..1859151
Genome map
AA seq 319 aa AA seqDB search
MEKNMLVGVDIGGTTVKIALIDIEGTMKMKWEINTNTAEHGKYIVSDIVHSVEEKLKENA
ISKDNVIGIGLGAPGFIDVEKGLIFEAVNLGWKDFALKEKMEEAIHIPTFVDNDANLAAV
GEMWQGAGEGAENLLCVTLGTGVGGGVIAGGEIIHGQSGMAGEIGHIATVLENGAPCNCG
KKGCLETVASATGIARLGTEAATVSTAGVLKDTLEANGALTAKDVFDAAKAGDTVAQNVV
KEASHHLGLVLANLANALNPEKIVLGGGVSKAGDILVGEIKKYFTSYAIPKIGRETHIKI
ATLGNDAGVYGAAWLAKQG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaacatgctagtaggagtagatataggtggaactacagtaaaaatcgccttg
attgatattgaaggtacgatgaaaatgaaatgggaaattaatacaaatacagcggaacat
ggaaaatatattgtttcagatatcgttcatagtgtggaagaaaaattaaaagagaatgcg
atcagtaaagataacgtgataggaattggtttgggggcaccaggctttattgatgttgag
aagggattaatctttgaagcggttaatttaggatggaaagattttgcgttaaaggaaaaa
atggaagaagctattcatataccgacttttgttgataatgatgccaacttagcagccgta
ggtgaaatgtggcaaggggctggagaaggagcagaaaatctactctgtgttacattagga
actggtgttggcggaggcgtcattgctggtggagaaatcattcatggtcaaagtggtatg
gcgggtgaaatcggtcatattgcaacagtacttgaaaatggtgcgccttgtaattgtggg
aaaaagggttgtctagaaactgtcgcttctgctacaggtattgcacgcttaggaacggaa
gctgctacagtaagtacagcaggggtgttaaaagatacactggaagcaaatggtgcttta
acagctaaagatgtttttgatgcagctaaagctggtgataccgtagcacaaaatgttgtg
aaagaagcttctcaccatttaggtcttgttttagcaaatttagcaaatgcgctaaatcct
gaaaagattgtgttaggtggcggtgtttcaaaagcgggagatattttagttggtgagatt
aagaagtactttacatcttatgcgattccaaaaattggacgtgagacacatataaaaatt
gcaacattagggaatgatgctggtgtgtatggagcagcatggttagcaaagcaaggttaa

DBGET integrated database retrieval system