KEGG   Bacillus cellulosilyticus: Bcell_1878Help
Entry
Bcell_1878        CDS       T01389                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01130  Biosynthesis of antibiotics
bco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcell_1878
Enzymes [BR:bco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bcell_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh DHO_dh
Motif
Other DBs
NCBI-ProteinID: ADU30140
UniProt: E6TZG6
Position
2057169..2057960
Genome map
AA seq 263 aa AA seqDB search
MTTILDTIVAHKKQEVKERSYQFSEDREYNKRSFLEALQNPNRSMGIIAEVKKASPSKGV
LVDQFSPVDIAREYDKINIDAISVLTDERFFQGHDSYLMAVKECTSVPVLRKEFIVDEKQ
IYESKAIGADAILLIAAILDKQQIKEYMAIAEELDLDVLMEVHDEAEIEKVLSTAKPKMI
GVNNRNLKTFETTLETTKLLAKYISDDVTLISESGIKSSKDVQFLSNLGVNGLLVGEAFM
KEKNKGDMLSQWFMEAASHDYTS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaattttagacacaatagtagcccataagaaacaagaagtaaaggaaagatcg
tatcagttttctgaagaccgtgagtataataaaagatcttttctagaagcactgcaaaat
ccaaatagaagtatggggattattgcggaagtgaaaaaagcgagtccctcaaaaggcgta
cttgtagatcagttttcccctgtagacattgctagagaatacgataaaatcaatattgat
gcaatatcagttttaactgatgaacgattttttcaaggtcatgactcttatttgatggct
gtgaaagaatgtacatctgtaccggtattacgtaaggaattcattgttgatgagaaacaa
atctatgaatcgaaagcaattggggcagatgcaattttattaatcgcagctattttagat
aaacaacaaataaaagaatatatggcaattgctgaagaattggatttagatgtgttgatg
gaagtgcatgatgaggctgaaattgaaaaagttttaagcactgctaaaccgaaaatgatt
ggagtaaataatagaaatttaaaaacattcgaaacaacgttagaaacaacaaagttactt
gccaagtatatttcagatgatgtcaccttgattagtgaaagtggtattaaaagttctaag
gatgttcagtttttgtcaaacttaggtgtcaatggtctcttagtgggagaagcatttatg
aaagagaaaaataaaggagatatgttgtcacaatggtttatggaggcagcctctcatgac
tacacttcttaa

DBGET integrated database retrieval system