KEGG   Bacillus cellulosilyticus: Bcell_1879Help
Entry
Bcell_1879        CDS       T01389                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcell_1879
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_1879
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcell_1879
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcell_1879
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Bcell_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2057944..2059779
Genome map
AA seq 611 aa AA seqDB search
MTTLLKFCGITNFKDYDKAVESGVDYIGVIFAKSKRQVKAEDVKQWTLRKPLQSHQRLVG
VFVNERESVIKKIATTCNLDIVQCHGTEKRDEISKLKENIQAQIFKTIHHHEKALLTMRE
YKGTVDGFVIDTKTDAEWGGTGIRFDWNSIPKYQFEALSQRVPCMIAGGVKVDNIDELMT
YNPIGIDVSSGIETNGIKDERKMAKMASKVKNNYAAPDKLGRFGDFGGRYVPETLMYALE
QLESAFDEAVQDEHFFAELHNEWEKYSGRPTPLTVAERLSKTLGGASIYLKREDLNHTGA
HKINNAIAQAILAKRMGKQQIIAETGAGQHGVAAATVAARFGLTCKVFMGEEDMKRQELN
VFRMKLLGAEVIKVTSGGKTLKDATNEAIRHWVSHVNDTFYLIGSAVGPHPYPKMVREFQ
SVIGRESRRQFLTETGALPDEVIACVGGGSNAIGMFYPFINDEQVVLTGVEAAGKGVDTE
EHAATLTKGVKGVLHGSLSYLLQDDFGNITEPYSISAGLDYPGIGPEHAYLRDIGRVSYE
SITDKEAIEALQTLCQLEGILPAIESAHALAQAFKRAKELSEGKTILVCLSGRGDKDVHT
IQGVLEGDNNE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgactacacttcttaagttttgcggaattacaaattttaaagattatgacaaagcagtt
gaaagtggtgtagattatataggtgtaatttttgcaaagagtaaaagacaagtgaaggct
gaggatgtgaaacaatggacattgaggaaacctttacagtctcatcaaagactcgtaggg
gtttttgttaatgagcgagaaagtgtcataaagaagatcgcgacaacgtgtaatctagat
atagttcaatgtcatggaacggaaaaacgagatgaaataagcaaattaaaagaaaacata
caagcacaaattttcaaaactattcaccatcatgaaaaggcgttgttgacgatgagggag
tataaaggcactgtagacggctttgttattgatacgaaaacagatgctgaatggggagga
actgggatacgttttgattggaatagtattccgaagtatcaattcgaagcactgagtcaa
cgagtgccttgtatgattgctggtggagtgaaagtggataatattgatgaactaatgact
tataatcctatcggtatcgatgtttcatcagggattgaaacaaacgggataaaagacgaa
aggaagatggcaaaaatggcttctaaagtaaaaaacaactatgcggcaccagataaatta
gggagatttggagactttggtggaaggtatgtaccggaaaccttaatgtatgcacttgaa
cagttagaatcagcctttgatgaggcggtacaggatgaacatttctttgctgagttacac
aatgaatgggagaaatattctgggagaccaacgcctttaacggtagcagaaaggctatca
aaaacattagggggagcttcaatatatttaaagagagaagacttaaaccatacaggtgct
cataaaatcaacaacgctattgctcaagcaatccttgcaaaacgaatgggcaaacagcaa
attattgctgaaactggagctggccaacatggagttgctgctgcgactgtagctgcaagg
tttggacttacatgtaaagtgtttatgggtgaagaggatatgaaacgtcaggaattaaat
gtctttcgcatgaagctgcttggtgcagaagtaattaaagtaacgagtggtggaaaaaca
ttaaaggatgctacaaatgaagcgatcagacattgggtatcacacgtaaatgatacattt
tatttaattgggtctgcagttggacctcatccatatcctaaaatggtaagggagttccaa
tctgttatcgggcgtgaaagtagaagacagtttcttactgaaacaggagcactaccagat
gaggttattgcttgtgtcggtggtggaagtaatgcaattgggatgttttacccgtttatc
aatgatgagcaagttgttttaacaggagtagaagctgcaggaaaaggagtagatacagaa
gaacacgccgctactttaacaaaaggcgtgaaaggtgtattgcacggctcactatcttat
ttattacaagacgactttggaaacattacagaaccatattctatttcagcaggtctagac
tatcctggcattggaccagagcacgcttatttaagagatatcggcagagtttcatatgaa
tctattactgataaggaagcaatagaagcccttcaaacactatgtcaactagagggtatt
cttcctgctattgaatctgcacatgcgttagcccaagcctttaaaagggcaaaagagcta
tctgaaggtaaaacaatattagtttgtctatctggcaggggtgataaggacgttcacaca
attcaaggtgtattggagggggataataatgaatag

DBGET integrated database retrieval system