KEGG   Bacillus cellulosilyticus: Bcell_1880Help
Entry
Bcell_1880        CDS       T01389                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcell_1880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_1880
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcell_1880
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcell_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2059772..2060569
Genome map
AA seq 265 aa AA seqDB search
MNRLLKEDFQSKRNKFVPYIMAGDPSMEATIDIALALQDAGVDAIEWGIPFSDPLADGPV
IQAAGERARSNGMNIIKAIEGVKEARRKGLTIPVILFTYVNPVLAYGEDNLIEEMKSADI
DGLLIPDLPIEESEKIRISCKDNGISFISLVTLSSKSRLEKICTQGDGFIYFVSSLGVTG
TRNQFSEDLSSSIAAVKEFTSVPVLIGFGISKKEHVQSFNQISDGVIVGSALVSFIGTRN
QELLCENDRKKAVDDIKEFVVELIS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatagactactaaaggaagatttccaatcaaaaagaaataaatttgtaccgtatatc
atggcaggagatccgtcaatggaagcaacaattgatattgcccttgcccttcaagatgct
ggtgtagatgcaattgagtggggtatcccctttagtgatccgttagcagatggaccagtt
attcaagcagcaggagaacgtgcaagatctaatggaatgaatataataaaagcaatagaa
ggtgtaaaggaagcacgaaggaagggcctaaccattccagttatattgttcacctatgtt
aatccagtgttggcctacggggaagataacttaatagaagagatgaaaagcgcagatatc
gatggcttactcatccctgatcttccgattgaagaaagtgaaaaaattagaataagctgt
aaggataatggcatatccttcatttcgttagttacactcagttcaaaaagtaggttggaa
aagatttgcactcaaggcgatggctttatatattttgtatcttcattaggtgttactgga
acacgcaatcaattttctgaagatttatcaagttcaatagcagctgtaaaggaatttaca
tctgtgcccgtattaataggatttggtatatcaaaaaaagagcacgtacaatcatttaat
caaataagtgatggtgttatcgtcggaagtgcgcttgtcagttttatcggaacacgtaat
caagaacttttatgcgaaaatgatagaaaaaaagcagttgatgacataaaagaatttgta
gtagaactcatttcataa

DBGET integrated database retrieval system