KEGG   Bacillus cellulosilyticus: Bcell_1880Help
Entry
Bcell_1880        CDS       T01389                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bco01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bco00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bco00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2059772..2060569
Genome map
AA seq 265 aa AA seqDB search
MNRLLKEDFQSKRNKFVPYIMAGDPSMEATIDIALALQDAGVDAIEWGIPFSDPLADGPV
IQAAGERARSNGMNIIKAIEGVKEARRKGLTIPVILFTYVNPVLAYGEDNLIEEMKSADI
DGLLIPDLPIEESEKIRISCKDNGISFISLVTLSSKSRLEKICTQGDGFIYFVSSLGVTG
TRNQFSEDLSSSIAAVKEFTSVPVLIGFGISKKEHVQSFNQISDGVIVGSALVSFIGTRN
QELLCENDRKKAVDDIKEFVVELIS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatagactactaaaggaagatttccaatcaaaaagaaataaatttgtaccgtatatc
atggcaggagatccgtcaatggaagcaacaattgatattgcccttgcccttcaagatgct
ggtgtagatgcaattgagtggggtatcccctttagtgatccgttagcagatggaccagtt
attcaagcagcaggagaacgtgcaagatctaatggaatgaatataataaaagcaatagaa
ggtgtaaaggaagcacgaaggaagggcctaaccattccagttatattgttcacctatgtt
aatccagtgttggcctacggggaagataacttaatagaagagatgaaaagcgcagatatc
gatggcttactcatccctgatcttccgattgaagaaagtgaaaaaattagaataagctgt
aaggataatggcatatccttcatttcgttagttacactcagttcaaaaagtaggttggaa
aagatttgcactcaaggcgatggctttatatattttgtatcttcattaggtgttactgga
acacgcaatcaattttctgaagatttatcaagttcaatagcagctgtaaaggaatttaca
tctgtgcccgtattaataggatttggtatatcaaaaaaagagcacgtacaatcatttaat
caaataagtgatggtgttatcgtcggaagtgcgcttgtcagttttatcggaacacgtaat
caagaacttttatgcgaaaatgatagaaaaaaagcagttgatgacataaaagaatttgta
gtagaactcatttcataa

DBGET integrated database retrieval system