KEGG   Bacillus cellulosilyticus: Bcell_1880Help
Entry
Bcell_1880        CDS       T01389                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcell_1880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_1880
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcell_1880
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcell_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2059772..2060569
Genome map
AA seq 265 aa AA seqDB search
MNRLLKEDFQSKRNKFVPYIMAGDPSMEATIDIALALQDAGVDAIEWGIPFSDPLADGPV
IQAAGERARSNGMNIIKAIEGVKEARRKGLTIPVILFTYVNPVLAYGEDNLIEEMKSADI
DGLLIPDLPIEESEKIRISCKDNGISFISLVTLSSKSRLEKICTQGDGFIYFVSSLGVTG
TRNQFSEDLSSSIAAVKEFTSVPVLIGFGISKKEHVQSFNQISDGVIVGSALVSFIGTRN
QELLCENDRKKAVDDIKEFVVELIS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatagactactaaaggaagatttccaatcaaaaagaaataaatttgtaccgtatatc
atggcaggagatccgtcaatggaagcaacaattgatattgcccttgcccttcaagatgct
ggtgtagatgcaattgagtggggtatcccctttagtgatccgttagcagatggaccagtt
attcaagcagcaggagaacgtgcaagatctaatggaatgaatataataaaagcaatagaa
ggtgtaaaggaagcacgaaggaagggcctaaccattccagttatattgttcacctatgtt
aatccagtgttggcctacggggaagataacttaatagaagagatgaaaagcgcagatatc
gatggcttactcatccctgatcttccgattgaagaaagtgaaaaaattagaataagctgt
aaggataatggcatatccttcatttcgttagttacactcagttcaaaaagtaggttggaa
aagatttgcactcaaggcgatggctttatatattttgtatcttcattaggtgttactgga
acacgcaatcaattttctgaagatttatcaagttcaatagcagctgtaaaggaatttaca
tctgtgcccgtattaataggatttggtatatcaaaaaaagagcacgtacaatcatttaat
caaataagtgatggtgttatcgtcggaagtgcgcttgtcagttttatcggaacacgtaat
caagaacttttatgcgaaaatgatagaaaaaaagcagttgatgacataaaagaatttgta
gtagaactcatttcataa

DBGET integrated database retrieval system