KEGG   Bacillus cellulosilyticus: Bcell_1938Help
Entry
Bcell_1938        CDS       T01389                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bco  Bacillus cellulosilyticus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bco00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bco00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2113942..2114610)
Genome map
AA seq 222 aa AA seqDB search
MNKVEHQLNDKSLITLAGTVGVGKSTLTNTLADALGYKAAFEKVDGNPYLEDYYSNFKTW
SFHLQIYFLAERFKQQKGMHETELGYVQDRSIYEDVGIFAKLQYDNGNMTDRDYETYRSL
FEAMVLSPYFPKPDVLIYIDGSLEDIINRIHERGRQMEINTPHSFWENLYSRYKNWIASF
NICPILHLDINSYDCRDSDSVKEIITQIEKLQKNPELKYVKL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtggagcaccaattaaatgataaatcattaattacgttagctggaacagta
ggcgtcggaaaatcaacattaacaaacacattagcagatgctcttgggtacaaagctgcc
tttgaaaaagtagatgggaatccgtatcttgaagattattattctaactttaaaacttgg
tcgttccatttgcaaatatattttttggctgagcgatttaagcaacagaaaggcatgcat
gaaacagagcttggatatgttcaagacaggagtatatatgaggacgtaggtattttcgca
aagctgcaatatgataatggaaacatgactgatcgtgattacgaaacatatcgctcgtta
tttgaagcgatggtactctctccttatttccctaaacctgatgttcttatctatattgat
ggtagcttggaagatataataaatagaatacatgaacgcggcagacaaatggaaataaac
acgccacattccttttgggagaatctatactctcgttataaaaactggatagcttccttt
aatatttgccctatccttcatttagatattaattcgtatgattgtcgtgattctgattca
gtaaaggaaatcattacgcaaattgaaaagctacaaaaaaatcctgaattaaaatacgtg
aagctttaa

DBGET integrated database retrieval system