KEGG   Bacillus cellulosilyticus: Bcell_1949Help
Entry
Bcell_1949        CDS       T01389                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00010  Glycolysis / Gluconeogenesis
bco00620  Pyruvate metabolism
bco00640  Propanoate metabolism
bco00680  Methane metabolism
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
bco01130  Biosynthesis of antibiotics
bco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_1949
   00620 Pyruvate metabolism
    Bcell_1949
   00640 Propanoate metabolism
    Bcell_1949
  Energy metabolism
   00680 Methane metabolism
    Bcell_1949
Enzymes [BR:bco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcell_1949
Lipid biosynthesis proteins [BR:bco01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcell_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ADU30211
UniProt: E6U095
Position
complement(2122878..2124602)
Genome map
AA seq 574 aa AA seqDB search
MSILQPKLGNYNLENYDVMKERFHWDDVKSQFSWSKTGKVNLAYEAIDRHVANGKGEKVA
LIYSDSLREEMYTFSEMKHETNKAAAMFKKYNVAKGDRVFIFMPRTPELYICLLGAIKVG
AVVGPLFEAFMKEAVRSRLEDSEATIIVTTPELLPRIPIAELPHLQTIILVGEEEKLSTG
SGKKFVSYYSEMESTVSDDNTIEWVDLEDGLILHYTSGSTGKPKGVYHVHNAMLQHYQTA
KWVLDLKEDDIYWCTADPGWVTGTSYGIFGPWLNGVTNVVRGGRFSPDDWYKTIEKYQVS
VWYSAPTAFRMLMAAAPEIMKKYDLSSIRHVLSVGEPLNPEVVRWGFETLHHRIHDTWWM
TETGAMLICNYLSEPIKPGSMGKPVPGVEAAIINDKGEKLPPYEMGHLAIKAGWPSMMRK
IWKNELKYNEYYSIPGWYVSGDTAYQDEDGYFWFQGRNDDVIMTSGERVGPFEIESKLVE
HPAVAEAGVIGKPDEIRGHIIKAFVSLREGYEYSDELKQEIQAFIKKELSAHAVPREIEF
KDKLPKTRSGKIMRRVLKAWELNEPAGDLSTMED
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgagtatacttcaacctaaattaggaaattacaacctagaaaactatgatgttatgaaa
gagcgttttcactgggatgatgtaaaatctcaattttcttggtcaaaaactggaaaagta
aacttagcctatgaggctattgatcggcatgtcgctaatggaaaaggggaaaaagttgca
ctcatttattcagattctttacgggaagaaatgtatacgttttcagaaatgaagcatgaa
acaaataaagcagctgcaatgtttaaaaaatataatgtagcaaaaggggatagagtgttt
attttcatgcctagaactccagagctatatatatgcttgttaggtgctattaaggttggc
gcagttgttggccctctttttgaagcatttatgaaggaagcagtaagaagtcggcttgaa
gacagcgaagcaactataatcgttactacaccagaattactcccaagaatccccatagca
gagctaccgcatttacaaacaattattttagtaggtgaagaagaaaagttaagtacaggt
agtgggaaaaaatttgtttcctattattcagaaatggaatcaacagtttccgacgataat
acaatagaatgggttgatctagaggatggattaatcctccactatacttcaggctctaca
ggaaaaccaaaaggtgtttaccacgtacacaatgcaatgctccagcattatcaaactgca
aaatgggtgctagatctaaaagaagatgatatatactggtgtacagccgatcccggttgg
gtaactggtacatcatatggtatattcggcccatggcttaatggagtaacaaatgttgtt
agaggcggtaggttttcaccagatgactggtataaaacaattgaaaagtatcaagtctca
gtatggtatagtgcacctactgcatttcgaatgttaatggcagccgccccagaaataatg
aagaaatatgatttatcctctatacgacatgtcctaagcgttggtgaaccattaaatcct
gaggtagttcgttggggctttgaaacgttacatcacagaatacatgatacgtggtggatg
acagaaacaggtgccatgcttatatgtaactatttaagtgaaccaattaaaccaggttca
atgggaaaacctgttcctggtgttgaagccgctattataaatgataagggtgaaaagtta
cctccatatgaaatgggacatttagcaattaaggcaggatggccttcgatgatgagaaaa
atttggaaaaatgaattaaaatataatgaatactactctattccaggttggtatgtttcg
ggggatactgcctaccaagacgaagatggctacttttggtttcaaggacgaaatgatgat
gttattatgacgtctggggagagagtcggcccgtttgaaatagagagtaaacttgtcgaa
caccctgccgttgcagaagctggagtcattggaaaacctgatgaaatacgaggtcatatt
attaaggcgtttgtttctttacgtgaagggtacgaatattcagatgagctaaaacaagag
attcaggcatttattaaaaaagagctgtctgcgcatgccgtacctcgagaaatagagttt
aaagataagctccctaaaactagaagtggaaaaattatgcgaagagtattaaaagcttgg
gagttaaacgaacctgcaggtgatctatcaacgatggaagattaa

DBGET integrated database retrieval system