KEGG   Bacillus cellulosilyticus: Bcell_1959Help
Entry
Bcell_1959        CDS       T01389                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bco  Bacillus cellulosilyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcell_1959
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcell_1959
  Amino acid metabolism
   00310 Lysine degradation
    Bcell_1959
Enzymes [BR:bco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcell_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2136695..2137924
Genome map
AA seq 409 aa AA seqDB search
MIEIKVPELAESVKEATIAEWLKKEGESVQKGENLVELETDKVNIEISAEESGILSETLC
DEGDTVFVGDVIAKMNVDEETSSKKFENNKKDKAKDDLSSDFSHEHEEKKNFEKDIDKAR
PIASPAARKYAREKGIELNEITPKDPLGRVRKDDLKELENEKDNDEISNDKEEATSKKIE
RVRMSRRRQTIAKRLVEAQQNSAMLTTFNEVDMTKLLKLRDRKKDDFYEENGVKLGFMSF
FTKAVIGALKKYPYVNAEIEENEILLKKFYDIGIAVSTEEGLVVPVVRDADHLDFAGIEK
EVNSLAEKAHEKKLDINDLTGGTFTITNGGVFGSLWSTPILNTPQVGILGMHKIQMRPVA
IDEERFENRPMMYIALSYDHRIIDGKDAVGFLVKVKELIEDPESLLLQG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagataaaagtacctgaattagcggagtctgttaaagaagcgacaattgcagag
tggctaaaaaaagaaggggaatcagttcaaaaaggggaaaatctcgttgagttggaaaca
gataaagtaaatatagaaatttctgcagaagagtcgggtattttaagcgaaacgctttgt
gatgaaggtgatactgtttttgtaggagatgttatagctaaaatgaatgtcgatgaagag
acgtcatcgaagaagttcgagaataataagaaagataaagctaaagatgatctatcatcc
gatttttcacatgaacatgaagagaaaaagaattttgaaaaggatattgataaggcacgt
ccaatagctagtcctgctgcgagaaagtatgcaagagaaaaaggcattgaattgaatgaa
ataacgccaaaagacccgctaggtcgagtaaggaaagatgatctaaaagaacttgaaaat
gaaaaagataacgatgaaataagcaatgacaaagaggaggccacttctaaaaaaattgaa
cgggttcgtatgtcgagacggcgacaaactattgcaaaaaggcttgtagaagcacaacaa
aattcagcaatgttgacaacgtttaatgaagttgatatgacaaaattattaaagttgaga
gatcgtaaaaaggatgacttctatgaggaaaatggtgtaaaattaggatttatgtcattt
tttactaaagcggttattggcgcactaaaaaaatatccttatgttaatgccgaaatagaa
gagaacgaaatattattaaagaaattttatgacatcggtatagctgtttcaacggaagag
ggccttgttgttcctgttgttcgggatgcagatcaccttgattttgctggtattgaaaag
gaagtgaatagtttagctgaaaaagcacatgaaaagaaattagatatcaatgatttaacc
ggaggcacttttacaattacaaatggtggtgtatttggctctttatggtcaacacctatt
ttgaacacacctcaagtagggatattgggaatgcataaaatacaaatgcgccctgttgct
attgatgaagaaagatttgaaaataggccaatgatgtatatagcactttcgtatgatcat
agaattattgatggtaaagatgctgtaggatttttagtgaaagttaaggaacttattgag
gaccctgaatctttattactccaagggtaa

DBGET integrated database retrieval system