KEGG   Bacillus cellulosilyticus: Bcell_1959Help
Entry
Bcell_1959        CDS       T01389                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00020  Citrate cycle (TCA cycle)
bco00310  Lysine degradation
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
bco01130  Biosynthesis of antibiotics
bco01200  Carbon metabolism
Module
bco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcell_1959
  Amino acid metabolism
   00310 Lysine degradation
    Bcell_1959
Enzymes [BR:bco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcell_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N Presenilin
Motif
Other DBs
NCBI-ProteinID: ADU30221
UniProt: E6U0A5
Position
2136695..2137924
Genome map
AA seq 409 aa AA seqDB search
MIEIKVPELAESVKEATIAEWLKKEGESVQKGENLVELETDKVNIEISAEESGILSETLC
DEGDTVFVGDVIAKMNVDEETSSKKFENNKKDKAKDDLSSDFSHEHEEKKNFEKDIDKAR
PIASPAARKYAREKGIELNEITPKDPLGRVRKDDLKELENEKDNDEISNDKEEATSKKIE
RVRMSRRRQTIAKRLVEAQQNSAMLTTFNEVDMTKLLKLRDRKKDDFYEENGVKLGFMSF
FTKAVIGALKKYPYVNAEIEENEILLKKFYDIGIAVSTEEGLVVPVVRDADHLDFAGIEK
EVNSLAEKAHEKKLDINDLTGGTFTITNGGVFGSLWSTPILNTPQVGILGMHKIQMRPVA
IDEERFENRPMMYIALSYDHRIIDGKDAVGFLVKVKELIEDPESLLLQG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagataaaagtacctgaattagcggagtctgttaaagaagcgacaattgcagag
tggctaaaaaaagaaggggaatcagttcaaaaaggggaaaatctcgttgagttggaaaca
gataaagtaaatatagaaatttctgcagaagagtcgggtattttaagcgaaacgctttgt
gatgaaggtgatactgtttttgtaggagatgttatagctaaaatgaatgtcgatgaagag
acgtcatcgaagaagttcgagaataataagaaagataaagctaaagatgatctatcatcc
gatttttcacatgaacatgaagagaaaaagaattttgaaaaggatattgataaggcacgt
ccaatagctagtcctgctgcgagaaagtatgcaagagaaaaaggcattgaattgaatgaa
ataacgccaaaagacccgctaggtcgagtaaggaaagatgatctaaaagaacttgaaaat
gaaaaagataacgatgaaataagcaatgacaaagaggaggccacttctaaaaaaattgaa
cgggttcgtatgtcgagacggcgacaaactattgcaaaaaggcttgtagaagcacaacaa
aattcagcaatgttgacaacgtttaatgaagttgatatgacaaaattattaaagttgaga
gatcgtaaaaaggatgacttctatgaggaaaatggtgtaaaattaggatttatgtcattt
tttactaaagcggttattggcgcactaaaaaaatatccttatgttaatgccgaaatagaa
gagaacgaaatattattaaagaaattttatgacatcggtatagctgtttcaacggaagag
ggccttgttgttcctgttgttcgggatgcagatcaccttgattttgctggtattgaaaag
gaagtgaatagtttagctgaaaaagcacatgaaaagaaattagatatcaatgatttaacc
ggaggcacttttacaattacaaatggtggtgtatttggctctttatggtcaacacctatt
ttgaacacacctcaagtagggatattgggaatgcataaaatacaaatgcgccctgttgct
attgatgaagaaagatttgaaaataggccaatgatgtatatagcactttcgtatgatcat
agaattattgatggtaaagatgctgtaggatttttagtgaaagttaaggaacttattgag
gaccctgaatctttattactccaagggtaa

DBGET integrated database retrieval system