KEGG   Bacillus cellulosilyticus: Bcell_1959Help
Entry
Bcell_1959        CDS       T01389                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bco  Bacillus cellulosilyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcell_1959
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcell_1959
  Amino acid metabolism
   00310 Lysine degradation
    Bcell_1959
Enzymes [BR:bco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcell_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2136695..2137924
Genome map
AA seq 409 aa AA seqDB search
MIEIKVPELAESVKEATIAEWLKKEGESVQKGENLVELETDKVNIEISAEESGILSETLC
DEGDTVFVGDVIAKMNVDEETSSKKFENNKKDKAKDDLSSDFSHEHEEKKNFEKDIDKAR
PIASPAARKYAREKGIELNEITPKDPLGRVRKDDLKELENEKDNDEISNDKEEATSKKIE
RVRMSRRRQTIAKRLVEAQQNSAMLTTFNEVDMTKLLKLRDRKKDDFYEENGVKLGFMSF
FTKAVIGALKKYPYVNAEIEENEILLKKFYDIGIAVSTEEGLVVPVVRDADHLDFAGIEK
EVNSLAEKAHEKKLDINDLTGGTFTITNGGVFGSLWSTPILNTPQVGILGMHKIQMRPVA
IDEERFENRPMMYIALSYDHRIIDGKDAVGFLVKVKELIEDPESLLLQG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagataaaagtacctgaattagcggagtctgttaaagaagcgacaattgcagag
tggctaaaaaaagaaggggaatcagttcaaaaaggggaaaatctcgttgagttggaaaca
gataaagtaaatatagaaatttctgcagaagagtcgggtattttaagcgaaacgctttgt
gatgaaggtgatactgtttttgtaggagatgttatagctaaaatgaatgtcgatgaagag
acgtcatcgaagaagttcgagaataataagaaagataaagctaaagatgatctatcatcc
gatttttcacatgaacatgaagagaaaaagaattttgaaaaggatattgataaggcacgt
ccaatagctagtcctgctgcgagaaagtatgcaagagaaaaaggcattgaattgaatgaa
ataacgccaaaagacccgctaggtcgagtaaggaaagatgatctaaaagaacttgaaaat
gaaaaagataacgatgaaataagcaatgacaaagaggaggccacttctaaaaaaattgaa
cgggttcgtatgtcgagacggcgacaaactattgcaaaaaggcttgtagaagcacaacaa
aattcagcaatgttgacaacgtttaatgaagttgatatgacaaaattattaaagttgaga
gatcgtaaaaaggatgacttctatgaggaaaatggtgtaaaattaggatttatgtcattt
tttactaaagcggttattggcgcactaaaaaaatatccttatgttaatgccgaaatagaa
gagaacgaaatattattaaagaaattttatgacatcggtatagctgtttcaacggaagag
ggccttgttgttcctgttgttcgggatgcagatcaccttgattttgctggtattgaaaag
gaagtgaatagtttagctgaaaaagcacatgaaaagaaattagatatcaatgatttaacc
ggaggcacttttacaattacaaatggtggtgtatttggctctttatggtcaacacctatt
ttgaacacacctcaagtagggatattgggaatgcataaaatacaaatgcgccctgttgct
attgatgaagaaagatttgaaaataggccaatgatgtatatagcactttcgtatgatcat
agaattattgatggtaaagatgctgtaggatttttagtgaaagttaaggaacttattgag
gaccctgaatctttattactccaagggtaa

DBGET integrated database retrieval system