KEGG   Bacillus cellulosilyticus: Bcell_1976Help
Entry
Bcell_1976        CDS       T01389                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcell_1976
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_1976
   00620 Pyruvate metabolism
    Bcell_1976
   00650 Butanoate metabolism
    Bcell_1976
  Lipid metabolism
   00071 Fatty acid degradation
    Bcell_1976
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcell_1976
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcell_1976
   00626 Naphthalene degradation
    Bcell_1976
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcell_1976
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bcell_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2165414..2168038
Genome map
AA seq 874 aa AA seqDB search
MAVEEREVKKVNDVTKMINDLVANAKSAHEEFLHFDQEKVDVIVKEMALAGLDQHMPLAK
MAVEETKRGVYEDKIIKNIFATEYIHNAIKYNKTVGIISENEHEEIIEVAEPVGVVAGVT
PVTNPTSTTMFKILISIKTRNPIIFAFHPSAQKCSAKAADVLYEAAVKAGAPKNCIQYIH
LPSIEATQQLMNHPGVAVVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKTATVKQAI
NDLILSKTFDNGMICASEQAVIIDREIYNEAKQELISNKCHFLTKDEIKKLEELVFPGSN
AAPGTYCAINGDIVGKSAATIAKMAGFEVADDTKILIAELKAVGMEHPLSREKLSPVLAC
YKVNSTEEGFKRANEMLELGGLGHSAVIHTNDEEIMKQYGIRMRAGRIITNSPSSQGAIG
DIYNGYLPSLTLGCGSYGRNSVSQNVGTLNLVNYKKIGKRKNNMQWFKIPPKVYFEKNST
QYLEKMPDISRVLIITDPIMVKMGYVDKIAYYLNKRQDKVQYQVFSDVEPDPSIETVMAG
AEMMHKFQPDAIIALGGGSPMDAAKGMWLFYEYPEVEFHGLKQKFLDIRKRVFKYPKLGR
KAQFIAIPTTSGTGSEVTSFSVITDKSSGTKYPLADYELTPDVAIIDPTYVKSVPKVVTA
DTGMDVLTHALEAYVSVMANDYTDGLAIKAIQLIFEYLPQAYDNGNNELAREKVHNASTI
AGMAFANAFLGINHSLAHKLGAEFHIAHGRSNTILMPHVIRYNATKPTKFTAFPKYSHFK
ADERYAEIARILGLPAKTTEEGVESLIDAVIKLAKRLEIPMSVEACGVSKEEFEAKVDYL
ADRAFEDQCTTANPKLPLVTELAEIYRKAYKGIK
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaagagagagaagttaaaaaagtgaacgatgttacaaagatgattaatgat
ttagtagccaatgctaaaagtgcgcatgaagaatttttgcattttgatcaagaaaaagta
gatgtcatcgtaaaagagatggcacttgctgggttagatcaacatatgcctttagcaaaa
atggctgttgaagagacaaaaagaggagtatatgaagacaaaatcataaaaaatatattt
gctaccgaatatattcacaatgcaattaaatataacaagacggttggcattatttctgaa
aatgaacatgaagaaattattgaagtagctgaaccagttggtgtagtagctggagttact
cctgttacaaatcctacttctacaacaatgttcaaaatactcatttcgattaaaacaaga
aacccaattatatttgcattccacccttctgcacagaagtgtagtgctaaagctgcagat
gtattgtacgaagctgctgttaaagctggtgcaccgaaaaattgtattcaatatattcac
ctaccatctattgaagctacacagcaattaatgaaccatccaggtgttgcagtagtatta
gcaaccggtggtgcaggaatggttaaatcagcatatagtacaggaaaaccagcattagga
gttggacctggaaatgtcccttgttatattgagaaaactgcaactgtgaagcaagcaatt
aatgatcttattctatctaaaacttttgataatggaatgatttgtgcctctgaacaagct
gtgatcattgatagagaaatttataatgaagcaaaacaagagttaatcagtaataaatgt
catttccttacaaaagatgaaattaaaaagcttgaagaattagttttccctggtagtaat
gctgcacctggcacatattgtgcaatcaatggtgatattgttggtaaatcagccgcaact
attgcaaaaatggctggttttgaagtggcagacgatacaaaaatattaatagcagaactt
aaagctgtaggaatggaacaccctctttcaagagaaaaacttagcccagttttagcttgc
tataaagtcaatagtactgaggaaggtttcaagcgtgctaacgaaatgctagagttaggt
ggattaggacattctgctgttattcatacgaatgatgaagaaattatgaagcaatatggt
attagaatgagagctggaagaattataacaaatagcccatcatcacaaggtgcaatcgga
gatatttataacggttatttaccatcattaacacttgggtgcggctcttacggaaggaat
tcagtttcacaaaatgtaggaacacttaatttagtaaactataaaaagataggaaagaga
aaaaataatatgcaatggtttaaaattccaccaaaagtgtattttgagaagaattcaaca
cagtatttagaaaaaatgcctgacatctctagagtactgattatcactgaccctattatg
gtgaaaatgggttatgtcgataaaattgcttattacttgaacaaacgtcaagacaaagta
caatatcaagttttttctgatgtagagccggatccatctatcgaaactgttatggcaggg
gcagagatgatgcacaagttccaacctgatgccattattgctcttggtggaggatcacca
atggatgcagcaaaaggtatgtggttgttctatgaatatccagaagtagagttccatggt
ttaaaacaaaaattccttgatattcgtaagcgtgtatttaagtaccctaaacttggaaga
aaagcacaatttattgccataccaacaacatcaggtacaggttcagaagtaacctcattc
tctgtaattacagataaatcttcagggacaaaatatccgttagctgactatgaattaaca
cctgatgtcgcgattattgacccaacgtatgtgaaatcagttccgaaagtagttacagct
gacactggaatggacgtattaactcatgcattagaagcttatgtatctgtcatggcaaac
gattatactgatggcttagcaattaaagcaattcaattaatctttgaatatttaccacaa
gcatatgataatggaaacaatgagttagcgagagaaaaagttcataatgcatctacaata
gcaggaatggcttttgcaaatgcattcttaggaattaatcatagtttagcgcataaatta
ggggctgagttccatatcgcccatggccgctctaatacgatattaatgccacatgttatt
cgttacaatgcaacgaagccaacgaaatttactgcattcccaaaatattctcactttaaa
gcagatgagaggtatgcggagattgcgagaatcttaggcttaccagctaaaacgacagaa
gagggtgttgagagcctaattgatgcagttataaaattagcaaaacgacttgaaattcca
atgagcgtagaggcttgcggtgtttcaaaagaagaattcgaagctaaagttgattattta
gcagatcgtgcttttgaagatcaatgtactactgcaaatccgaagctaccacttgtaact
gaattggcagaaatttatcgtaaagcatataaagggattaaatag

DBGET integrated database retrieval system