KEGG   Bacillus cellulosilyticus: Bcell_2006Help
Entry
Bcell_2006        CDS       T01389                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00330  Arginine and proline metabolism
bco00332  Carbapenem biosynthesis
bco01100  Metabolic pathways
bco01130  Biosynthesis of antibiotics
bco01230  Biosynthesis of amino acids
Module
bco_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcell_2006
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Bcell_2006
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bcell_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADU30268
UniProt: E6U0V6
Position
complement(2199346..2200452)
Genome map
AA seq 368 aa AA seqDB search
MSKKRIVVKIGSSSLTKNNGELHIGKLTEHTEAIVELKKKGHDIILISSGAVAAGFKKLG
YPTRPVKIAGKQAAAAVGQGLLIQGYTEAFQKHSIAVAQLLLTRNDFVNQEQYKNAYATL
TELLKRDVVPIINENDSTSIEELTFGDNDMLSALVSGLIHADHLIILTDINGLYDEDPRK
NKDAKKYHFLPEITGNLLIEAKENGSKLGTGGMKSKINAAKTAFSLGVNNIFIGSGYGAT
KLHDILLGKGDGTYIGKSERKVLNNKKQWIAFHSSSSGKIVIDTGAVQALLNKGRSLLPV
GITEVYGSFQEGAVVEIINEKGKIIGKGQVNYSSDELLEIKGKDSCDAKKFTNKATVEAI
HRDHLLIL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaacgaatcgttgtaaaaataggaagtagctcgctaacgaagaataatgga
gaattgcatatcggaaaactaaccgagcatactgaagcaattgtggaattgaagaaaaag
ggccacgatataattttgatttcttctggagcagtggctgccggattcaaaaaacttggt
tatccaactagaccggttaagattgcaggcaagcaggcagcagcagcggttggccaaggt
cttctcattcaaggctatactgaagcattccaaaagcatagcattgcagttgcccaatta
ttactcacaagaaatgatttcgttaatcaagaacaatataagaatgcttatgctacattg
actgaactacttaaacgggatgttgtcccaataatcaatgaaaatgattctacttccata
gaagaattaacatttggagataatgatatgctttccgcactagtaagtggtcttatccat
gcagatcaccttatcattcttactgatataaacggactttacgatgaagatcctcgtaaa
aataaagatgcaaaaaaataccattttttacctgaaataacgggcaatctattaattgaa
gcgaaagagaacggttctaagttaggtactggtggaatgaagtcaaaaattaatgctgct
aaaactgctttttctttaggtgtaaataatatttttattggttcaggatatggggccact
aagcttcacgatattttactaggtaaaggtgatggaacttatattgggaaaagtgaacga
aaggtgttgaataataagaagcagtggatagcattccactcctcctcttctggaaaaatt
gttatcgacaccggtgccgttcaggcacttttaaataaagggagaagcctacttcctgtc
ggtataacagaagtttacggaagctttcaagaaggtgccgtagtagaaataataaacgaa
aaagggaaaataatcggaaaaggtcaagtaaattattcttcggacgaattgctagaaatt
aaaggtaaagatagctgcgatgcgaaaaagtttactaataaagcaacagtagaagcgatc
catagagatcatttattaatactataa

DBGET integrated database retrieval system