KEGG   Bacillus cellulosilyticus: Bcell_2176Help
Entry
Bcell_2176        CDS       T01389                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00010  Glycolysis / Gluconeogenesis
bco00020  Citrate cycle (TCA cycle)
bco00620  Pyruvate metabolism
bco00640  Propanoate metabolism
bco00650  Butanoate metabolism
bco00680  Methane metabolism
bco01100  Metabolic pathways
bco01120  Microbial metabolism in diverse environments
bco01130  Biosynthesis of antibiotics
bco01200  Carbon metabolism
Module
bco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_2176
   00020 Citrate cycle (TCA cycle)
    Bcell_2176
   00620 Pyruvate metabolism
    Bcell_2176
   00640 Propanoate metabolism
    Bcell_2176
   00650 Butanoate metabolism
    Bcell_2176
  Energy metabolism
   00680 Methane metabolism
    Bcell_2176
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Bcell_2176
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Bcell_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_C Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADU30437
UniProt: E6U259
Position
complement(2360394..2362694)
Genome map
AA seq 766 aa AA seqDB search
MAMTENDINKKNTGAGEQITTFESGNEMAATAAAQINYHVMGYFPITPSTEVAQYLDIMK
TKGLHDIELIAADGEHGSAGICFGAATTGARVFNATSANGLLYMLEQLPAQSGLRFPMVM
NLVTRAVSGPLDIRGDHSDLYYALNTGWVILTARTPQAVYDMNIMALKIAEHSDVRLPVI
VAYDGFYTSHQKRKVDYFKDNKVVQEFVGETPKGYPISIDKQHPVTIGAHMNGDDLLNNS
YQQSEALYRAYDVYKEVAAEYEELSGRNYDILDLYGMEDAEVALFLLNSAAESSKDVVDR
LRAKGIKAGVISPNIIRPFPAEEIRKALKNVKAVLVGERADSYGGNGANLTHEVKSALQE
DKDNQTIVLSRVFGLGGKDFYADDAENFFQLAIDAAELGYAFKPFDYYGQTPGDPEKKLE
QVIAPMTGDAYKTGLIKVTEDEESGKLKVRIPPLRQLTQKPKRFASGHGACPGCGIFPGL
ELFFKGIEGDAVILFHTGCGYVVTTGYPYTSHKQSFIHNLFQNGPATLSGTVEAFFEMKR
RGEINIDDDFTFVMVTGDGGMDIGMGSAIGTALRGHKMIILEYDNEGYMNTGSQMSYSTP
IGHMTSTTMVGKEKQGKTFHHKDTAQIMAATNIPYVFTGTEAFPQDLVKKAAKAQWYAQN
VGLVYGKILITCPLNWKSEDRHGETIMKAAVDSCFFPLYEIEQGETNITYNPETKKKRVD
LSEWLKYMGKSKHMLKEENKPLLEEFEKEVERRWNILKVKHETPFV
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgacagaaaacgatattaataagaaaaataccggtgctggtgaacaaataaca
acatttgaatctggcaatgaaatggcggctactgcagctgcacaaattaattatcatgta
atgggttattttcctattaccccttctactgaagtagcacaatatttagatattatgaaa
acgaaaggcctacatgatattgagttaatcgcagcagatggtgaacacggatcggctggt
atttgttttggagctgctacgacaggtgctcgtgtctttaacgcaacgagtgcaaacgga
ttactatatatgttagagcaacttcctgcccaatctggactccgttttcctatggtgatg
aacctcgttacacgtgctgtaagtggcccattagatatacgtggtgaccactctgacttg
tattatgcattaaatacaggatgggttattttaacagctcgcacccctcaagccgtttat
gacatgaacattatggctttgaaaattgctgagcattctgatgttcgtcttccagttatt
gttgcttatgatggattttatacttctcatcaaaagcgtaaagtagactactttaaagat
aacaaagtagttcaagagtttgtcggggaaacacctaaaggttatcctatttctattgat
aaacaacatccagtaacgataggtgctcatatgaacggtgatgacctattaaataacagc
taccaacaatctgaagcactttatcgcgcgtatgatgtatataaagaagtagcggcagaa
tacgaggagttatctggtcgtaactatgacattttagatctttacggcatggaagatgca
gaagttgccctcttcctactaaactcggcagctgaatcatctaaggatgttgtagatcgc
cttcgtgcaaaaggtattaaagctggcgtaattagcccaaatatcattcgtcctttccct
gctgaagagattcgtaaagcattaaaaaatgtgaaagcagtccttgtaggtgagcgtgca
gattcttacggtggtaacggtgctaatttaactcacgaagtaaaatctgcccttcaagaa
gataaagataatcaaacaatcgtattaagcagagtcttcggtttaggtgggaaagacttt
tatgctgatgatgcagagaacttttttcaattagctatagatgctgcagaactaggttat
gcttttaaaccatttgactattacggtcaaacacctggagatcctgagaaaaagcttgag
caagtaattgcaccgatgactggagacgcgtataaaacaggactcattaaagtgactgag
gatgaagagtctggcaagctaaaagttcgtatccctcctcttcgtcagttaacacaaaag
ccaaagcgatttgcttctggtcatggtgcttgtcctgggtgtggtatcttccctggatta
gagctattctttaaaggcattgaaggtgatgcggttatccttttccatactggctgtggt
tatgtagttacgacaggatatccttatacatcgcataagcaatcgtttatccataacttg
ttccaaaacggtcctgctacattatcagggactgtagaagctttctttgaaatgaaacgt
cgtggtgaaattaatattgatgatgattttacattcgtcatggttacgggtgatggtggt
atggacatcggaatgggttctgctatcggtactgcccttcgcggtcataagatgattatt
cttgaatatgataacgaaggctacatgaacactggatctcaaatgtcttattcaacacca
attggtcatatgacaagtacaacgatggttggtaaagaaaaacaaggaaaaacgtttcac
cataaagatactgcgcaaattatggcagctacaaacattccttatgtatttacaggtacc
gaggcgttccctcaggacttagtaaagaaagctgctaaagcacaatggtatgcccaaaat
gttggacttgtatatgggaaaattttaattacatgtccactaaactggaaatctgaagac
cgccatggagaaacaattatgaaagcagctgttgattcctgcttcttccctctctatgag
attgagcaaggggaaactaatataacgtataacccagaaacgaaaaaaaagcgagttgat
ctctcagagtggttaaaatatatgggtaaatcaaagcatatgttaaaagaagaaaacaaa
cctcttcttgaagagttcgaaaaagaagtagaacgccgctggaacattttaaaagtaaaa
catgaaactccatttgtataa

DBGET integrated database retrieval system