KEGG   Bacillus cellulosilyticus: Bcell_2367Help
Entry
Bcell_2367        CDS       T01389                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bco  Bacillus cellulosilyticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcell_2367
Enzymes [BR:bco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bcell_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2565631..2566581
Genome map
AA seq 316 aa AA seqDB search
MSKDMIYGNTPCFLGSENLVNSPNKEVDVVFYGVPWEGAVTWGDYTGCELGPKVMRLCSA
RYSGYLPELDHINITDHLTLGDLGDVSVVPAEPEKTKDEIKNFAKNVWKTNTFPIALGGD
HGITYPIIEGLIEAKNKRVGIIHLDAHYDNNKSSEGDPYGRGAPFARLYETEGVRNESIV
HFGIHGPRNKPENGKLAKEVGATTFTINDVRYSSDLRELTKKAYNIAATNTDIVYLSICS
DVLDHAFNPGGPVDGNGLTAHELLTIIYEICKQGIGGMDFVEVYPHQDNNDFSSHFASTI
VLYALAGEIRHQEQMN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagacatgatttacggaaatacaccttgttttttagggagtgaaaatttagtt
aactcacctaacaaagaggtagacgttgttttttatggtgttccttgggaaggcgctgtt
acttggggtgattatactggatgtgaacttggtccgaaggtgatgcgtctatgttcagca
agatacagcggttatttacctgaacttgatcatattaatataactgatcatcttacactt
ggtgatttaggagatgtttctgtagtacctgcagaaccagaaaaaacgaaagacgaaatt
aaaaatttcgctaaaaatgtatggaaaacgaatacatttccaattgcgcttggtggagac
catggaattacataccctattatagaaggtctaattgaagcaaaaaacaaaagggtaggt
attattcatttggatgcccactatgacaacaataaaagttctgaaggtgacccttatggg
cgtggtgctccattcgcccgtctatatgaaacagaaggtgttcgaaatgaaagtatcgta
cattttggaattcacggtccacgaaataaacccgaaaatgggaaactggcaaaagaggta
ggcgcaacaacatttacgataaatgatgttcgctattcttcagacttacgcgaattgact
aagaaagcttataacattgctgccactaatactgatattgtgtatttaagtatttgtagt
gatgtacttgatcatgcttttaaccctggtggacctgtcgatgggaatggcttaaccgca
catgaattacttacgatcatttatgaaatctgtaagcaaggaattggtggaatggatttt
gtagaagtctaccctcatcaagacaacaatgattttagctcacatttcgcgtctactatt
gtactctatgctttagctggtgaaatacgtcatcaggagcagatgaactaa

DBGET integrated database retrieval system