KEGG   Bacillus cellulosilyticus: Bcell_2367Help
Entry
Bcell_2367        CDS       T01389                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00330  Arginine and proline metabolism
bco01100  Metabolic pathways
Module
bco_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcell_2367
Enzymes [BR:bco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bcell_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Peptidase_C25
Motif
Other DBs
NCBI-ProteinID: ADU30626
UniProt: E6TRB4
Position
2565631..2566581
Genome map
AA seq 316 aa AA seqDB search
MSKDMIYGNTPCFLGSENLVNSPNKEVDVVFYGVPWEGAVTWGDYTGCELGPKVMRLCSA
RYSGYLPELDHINITDHLTLGDLGDVSVVPAEPEKTKDEIKNFAKNVWKTNTFPIALGGD
HGITYPIIEGLIEAKNKRVGIIHLDAHYDNNKSSEGDPYGRGAPFARLYETEGVRNESIV
HFGIHGPRNKPENGKLAKEVGATTFTINDVRYSSDLRELTKKAYNIAATNTDIVYLSICS
DVLDHAFNPGGPVDGNGLTAHELLTIIYEICKQGIGGMDFVEVYPHQDNNDFSSHFASTI
VLYALAGEIRHQEQMN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagacatgatttacggaaatacaccttgttttttagggagtgaaaatttagtt
aactcacctaacaaagaggtagacgttgttttttatggtgttccttgggaaggcgctgtt
acttggggtgattatactggatgtgaacttggtccgaaggtgatgcgtctatgttcagca
agatacagcggttatttacctgaacttgatcatattaatataactgatcatcttacactt
ggtgatttaggagatgtttctgtagtacctgcagaaccagaaaaaacgaaagacgaaatt
aaaaatttcgctaaaaatgtatggaaaacgaatacatttccaattgcgcttggtggagac
catggaattacataccctattatagaaggtctaattgaagcaaaaaacaaaagggtaggt
attattcatttggatgcccactatgacaacaataaaagttctgaaggtgacccttatggg
cgtggtgctccattcgcccgtctatatgaaacagaaggtgttcgaaatgaaagtatcgta
cattttggaattcacggtccacgaaataaacccgaaaatgggaaactggcaaaagaggta
ggcgcaacaacatttacgataaatgatgttcgctattcttcagacttacgcgaattgact
aagaaagcttataacattgctgccactaatactgatattgtgtatttaagtatttgtagt
gatgtacttgatcatgcttttaaccctggtggacctgtcgatgggaatggcttaaccgca
catgaattacttacgatcatttatgaaatctgtaagcaaggaattggtggaatggatttt
gtagaagtctaccctcatcaagacaacaatgattttagctcacatttcgcgtctactatt
gtactctatgctttagctggtgaaatacgtcatcaggagcagatgaactaa

DBGET integrated database retrieval system